DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Nrg

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001245581.1 Gene:Nrg / 31792 FlyBaseID:FBgn0264975 Length:1309 Species:Drosophila melanogaster


Alignment Length:271 Identity:73/271 - (26%)
Similarity:116/271 - (42%) Gaps:25/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 QTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPD 146
            ||:.:.....|..:.||   ...|...::.|:.....|.|.|.|.::.....:|.  ..:::..:
  Fly   277 QTVWSKDGQRIQWSDRI---TQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQS--FSIILNVN 336

  Fly   147 ILDYPTSTDMV--VREGSNVTLKCAATGSPEPTITWRRESGVPIELATGEEVMSIEGTDLVIPNV 209
            .:.|.|....:  ..|...|..:|.|.|.|||.|:| ..:|.|||.:|.....::....:.|.|:
  Fly   337 SVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISW-IHNGKPIEQSTPNPRRTVTDNTIRIINL 400

  Fly   210 RRHHMGAYLCIASNGVPPSVSKRITLVVHF-PPMITVQNQLIGAVEGKGVTLDCESEAYPKSINY 273
            .:...|.|.|.|:|.: ..|.|.:.|.|.. ||.|:.....:..|:|:.||:.|.....||.:..
  Fly   401 VKGDTGNYGCNATNSL-GYVYKDVYLNVQAEPPTISEAPAAVSTVDGRNVTIKCRVNGSPKPLVK 464

  Fly   274 WTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGD--TDGTIKL-- 334
            |.|....:.  ||:|  ||...|.      |.|..:|.::.|.|.|.|:|..|:  .||::.:  
  Fly   465 WLRASNWLT--GGRY--NVQANGD------LEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKE 519

  Fly   335 -YRIPPNAVNY 344
             .||.....||
  Fly   520 HTRITQEPQNY 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 12/58 (21%)
IG_like 51..137 CDD:214653 12/54 (22%)
IG_like 153..237 CDD:214653 25/85 (29%)
Ig 161..224 CDD:299845 20/62 (32%)
IG_like 252..335 CDD:214653 26/87 (30%)
Ig 258..333 CDD:143165 24/76 (32%)
NrgNP_001245581.1 Ig 55..128 CDD:299845
IG_like 57..127 CDD:214653
Ig 135..214 CDD:299845
IG_like 141..216 CDD:214653
ig 251..332 CDD:278476 12/59 (20%)
I-set 339..427 CDD:254352 27/89 (30%)
Ig 354..427 CDD:299845 24/74 (32%)
I-set 432..517 CDD:254352 28/94 (30%)
Ig 446..517 CDD:299845 25/80 (31%)
I-set 522..611 CDD:254352 4/9 (44%)
ig 525..609 CDD:278476 2/6 (33%)
FN3 613..707 CDD:238020
FN3 716..807 CDD:238020
fn3 817..905 CDD:278470
FN3 917..1004 CDD:238020
FN3 1041..1111 CDD:238020
Bravo_FIGEY 1155..>1221 CDD:290593
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12231
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.