DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr14

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:217 Identity:59/217 - (27%)
Similarity:97/217 - (44%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PKFSSP--IVNMTAPVGRDAFLTCVVQDLGPYKVAWL--RVDTQTILTIQNHVITKNQRIGIANS 103
            |.|:.|  .:|::..:....:|.|.|.||....|:|:  |.|..|::|...|..:.:.|..:...
  Fly    73 PFFADPYTTLNISTQLSSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYSLEFE 137

  Fly   104 EHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVP-PDILDYPTST--DMVVREGSNVT 165
            |...|.:.|:...|.|:|.|.||:::.|....:.||.::|| .:|||...|.  :...:.||.:.
  Fly   138 EPNDWKLLIQFANERDEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIE 202

  Fly   166 LKCAATGSPEPT--ITWRR----------ESGVPI--ELATGEEVMSIEGTDLVIPNVRRHHMGA 216
            |:|..:..|.|:  ||||.          ..|:.:  ::..|..:     :.|.|.|..|...|.
  Fly   203 LQCVISKIPHPSSYITWRHGPRLLNYDTSRGGISVKTDMLPGRAL-----SRLYIANANRQDTGN 262

  Fly   217 YLCIASNGVPPSVSKRITLVVH 238
            |.|:..|.:..      |:|||
  Fly   263 YTCMLGNEITE------TVVVH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 26/91 (29%)
IG_like 51..137 CDD:214653 24/87 (28%)
IG_like 153..237 CDD:214653 22/99 (22%)
Ig 161..224 CDD:299845 19/76 (25%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 23/79 (29%)
Ig 84..169 CDD:299845 23/84 (27%)
IG_like 191..279 CDD:214653 24/99 (24%)
Ig 201..274 CDD:143165 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.