Sequence 1: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001096850.2 | Gene: | dpr7 / 2768865 | FlyBaseID: | FBgn0053481 | Length: | 312 | Species: | Drosophila melanogaster |
Alignment Length: | 233 | Identity: | 57/233 - (24%) |
---|---|---|---|
Similarity: | 92/233 - (39%) | Gaps: | 39/233 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSE-HKTWTMRIKD 114
Fly 115 IKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPT----------------STDMVVREGSN 163
Fly 164 VTLKCAATGSPEPTITWRRESG-VPIELATGEEVMSIEGTD------LVIPNVRRHHMGAYLCIA 221
Fly 222 SNGVPPSVSKRITL--------------VVHFPPMITV 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 28/90 (31%) |
IG_like | 51..137 | CDD:214653 | 27/86 (31%) | ||
IG_like | 153..237 | CDD:214653 | 21/104 (20%) | ||
Ig | 161..224 | CDD:299845 | 15/69 (22%) | ||
IG_like | 252..335 | CDD:214653 | |||
Ig | 258..333 | CDD:143165 | |||
dpr7 | NP_001096850.2 | V-set | 56..145 | CDD:284989 | 27/84 (32%) |
IG_like | 58..140 | CDD:214653 | 25/79 (32%) | ||
IG_like | 179..265 | CDD:214653 | 21/86 (24%) | ||
Ig | 187..257 | CDD:299845 | 15/70 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |