DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr7

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:92/233 - (39%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSE-HKTWTMRIKD 114
            |::|.|...|.|.|.|::.|...|:|:|.....|||...:..|.:||..:.:.. .:.|.::|..
  Fly    60 NVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDY 124

  Fly   115 IKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPT----------------STDMVVREGSN 163
            .:..|.|.|.||:||:|..:....|.|:...|..|..|                ||::.|:..|.
  Fly   125 AQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDST 189

  Fly   164 VTLKCAATGSPEPTITWRRESG-VPIELATGEEVMSIEGTD------LVIPNVRRHHMGAYLCIA 221
            :.|.| :.....|::.|...|. |..:...|...:..|.||      |::........|.|.|:.
  Fly   190 IALAC-SVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVP 253

  Fly   222 SNGVPPSVSKRITL--------------VVHFPPMITV 245
            :..:|.||...:..              :..|..|||:
  Fly   254 NGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 28/90 (31%)
IG_like 51..137 CDD:214653 27/86 (31%)
IG_like 153..237 CDD:214653 21/104 (20%)
Ig 161..224 CDD:299845 15/69 (22%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr7NP_001096850.2 V-set 56..145 CDD:284989 27/84 (32%)
IG_like 58..140 CDD:214653 25/79 (32%)
IG_like 179..265 CDD:214653 21/86 (24%)
Ig 187..257 CDD:299845 15/70 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.