DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr7

DIOPT Version :10

Sequence 1:NP_608946.3 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:233 Identity:57/233 - (24%)
Similarity:92/233 - (39%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSE-HKTWTMRIKD 114
            |::|.|...|.|.|.|::.|...|:|:|.....|||...:..|.:||..:.:.. .:.|.::|..
  Fly    60 NVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDY 124

  Fly   115 IKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPT----------------STDMVVREGSN 163
            .:..|.|.|.||:||:|..:....|.|:...|..|..|                ||::.|:..|.
  Fly   125 AQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDST 189

  Fly   164 VTLKCAATGSPEPTITWRRESG-VPIELATGEEVMSIEGTD------LVIPNVRRHHMGAYLCIA 221
            :.|.| :.....|::.|...|. |..:...|...:..|.||      |::........|.|.|:.
  Fly   190 IALAC-SVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCVP 253

  Fly   222 SNGVPPSVSKRITL--------------VVHFPPMITV 245
            :..:|.||...:..              :..|..|||:
  Fly   254 NGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_608946.3 IG_like 51..137 CDD:214653 27/86 (31%)
Ig strand B 60..64 CDD:409353 2/3 (67%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 108..112 CDD:409353 1/3 (33%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
IgI_1_MuSK 145..237 CDD:409562 24/128 (19%)
Ig strand A 145..148 CDD:409562 1/2 (50%)
Ig strand A' 153..158 CDD:409562 2/4 (50%)
Ig strand B 164..171 CDD:409562 2/6 (33%)
Ig strand C 177..182 CDD:409562 1/4 (25%)
Ig strand C' 184..186 CDD:409562 1/2 (50%)
Ig strand D 194..197 CDD:409562 0/2 (0%)
Ig strand E 202..208 CDD:409562 3/11 (27%)
Ig strand F 215..222 CDD:409562 3/6 (50%)
Ig strand G 229..237 CDD:409562 1/21 (5%)
IG_like 252..335 CDD:214653
Ig strand B 258..262 CDD:409353
Ig strand C 271..282 CDD:409353
Ig strand E 301..306 CDD:409353
Ig strand F 316..321 CDD:409353
Ig strand G 329..332 CDD:409353
dpr7NP_001096850.2 V-set 56..145 CDD:462230 27/84 (32%)
Ig 184..267 CDD:472250 19/83 (23%)
Ig strand B 190..194 CDD:409353 1/3 (33%)
Ig strand C 202..206 CDD:409353 0/3 (0%)
Ig strand E 234..238 CDD:409353 1/3 (33%)
Ig strand G 261..264 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.