DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and dpr1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:213 Identity:64/213 - (30%)
Similarity:92/213 - (43%) Gaps:43/213 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRI------GIANSEHKTWT 109
            |:|..||:..||.|.|:.||...|:|:|.....|||......|.:||.      |.||     ||
  Fly    62 NLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSAN-----WT 121

  Fly   110 MRIKDIKESDKGWYMCQINTDPMKSQMGYLDVV-VPPDILDYPTSTDMVVREGSNVTLKCAATGS 173
            ::||..:..|.|.|.|||||:|..|.....:|| :..:|..   .:|::|:.||::.|.|.....
  Fly   122 LQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG---PSDLMVKTGSDINLTCKIMQG 183

  Fly   174 PEP--TITWRRESGVPIELATGEEVMSIEG-----------TD-----LVIPNVRRHHMGAYLCI 220
            |..  .|.|.:.|    |:..|:....|:.           ||     |.|........|.|.|:
  Fly   184 PHELGNIFWYKGS----EMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV 244

  Fly   221 ASNGVPPSVSKRITLVVH 238
                  |:|:|..::.||
  Fly   245 ------PTVAKTSSVYVH 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 36/95 (38%)
IG_like 51..137 CDD:214653 36/91 (40%)
IG_like 153..237 CDD:214653 23/101 (23%)
Ig 161..224 CDD:299845 18/80 (23%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
dpr1NP_001286645.1 Ig 59..154 CDD:299845 36/96 (38%)
IG_like 60..150 CDD:214653 36/92 (39%)
IG_like 163..257 CDD:214653 25/104 (24%)
Ig 174..244 CDD:143165 15/73 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.