DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Bsg

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001103352.1 Gene:Bsg / 25246 RGDID:2220 Length:388 Species:Rattus norvegicus


Alignment Length:254 Identity:61/254 - (24%)
Similarity:103/254 - (40%) Gaps:44/254 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 EHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKC 168
            :|...|:.:..:...|.|.|.|:.::||.::.:     ..||.:........:||.|...:....
  Rat    87 QHAASTLSVDGLAAEDTGTYECRASSD
PDRNHL-----TRPPRVKWVRAQASVVVLEPGTIVTSV 146

  Fly   169 AATGSPEPTITWRRESGVPI---ELATGEEVMSIEGTDLVIPNVRRHH-------MGAYLCIASN 223
            ....|......:...||:.|   ....|.:|:. |.|   :|:::..:       .|.|.||.  
  Rat   147 QEVDSKTQLTCFLNSSGIDIVGHRWMRGGKVLQ-EDT---LPDLQMKYTVDADDRSGEYSCIF-- 205

  Fly   224 GVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYW----TRERGEIVPP 284
             :|..|. |..:.|..||.|.|..:...|.||:.|.|.|:|||....::.|    |.:.|:....
  Rat   206 -LPEPVG-RGNINVEGPPRIKVGKKSEHASEGEFVKLICKSEASHPPVDEWVWFKTSDTGDQTIS 268

  Fly   285 GG-----KY----SANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKL 334
            .|     ||    :..::|:  ..:.:.::::|      |:|.|.|.||.|....||.|
  Rat   269 NGTEANSKYVIISTPELSEL--IISDLDMNVDP------GTYVCNATNSQGSARETISL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 8/36 (22%)
IG_like 51..137 CDD:214653 8/32 (25%)
IG_like 153..237 CDD:214653 19/93 (20%)
Ig 161..224 CDD:299845 13/72 (18%)
IG_like 252..335 CDD:214653 27/96 (28%)
Ig 258..333 CDD:143165 22/87 (25%)
BsgNP_001103352.1 IG_like 29..113 CDD:214653 6/25 (24%)
Ig 40..111 CDD:143165 6/23 (26%)
Ig 139..203 CDD:299845 11/67 (16%)
IG_like 228..321 CDD:214653 27/100 (27%)
Ig 238..318 CDD:143165 22/87 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.