DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DIP-eta and Lrit1

DIOPT Version :9

Sequence 1:	NP_001188701.2	Gene:	DIP-eta / 33793	FlyBaseID:	FBgn0031725	Length:	450	Species:	Drosophila melanogaster
Sequence 2:	NP_666357.2	Gene:	Lrit1 / 239037	MGIID:	2385320	Length:	624	Species:	Mus musculus

Alignment Length:	123	Identity:	43/123 - (34%)
Similarity:	61/123 - (49%)	Gaps:	12/123 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   151 PTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELATGEEVMSIEG---TDLVIPNVRRH 212
            |..|.::...||.|.|:|.|||.|.|.::|||.:|.|:.....:||.| :|   |.|.:|.|...
Mouse   259 PGVTSIISPLGSTVLLRCGATGIPGPEMSWRRANGRPLNGTVHQEVSS-DGSSWTLLDLPVVSLF 322

  Fly   213 HMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIG---AVEGKGVTLDCESEAY 267
            ..|.|:|.|.|.:..| ...|:|:|..|...|..:.:.|   |..|:|    .|:.||
Mouse   323 DSGDYICQAKNFLGAS-ETLISLIVTEPQTSTGYSGIPGVLWARTGEG----AEAAAY 375

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DIP-eta	NP_001188701.2	Ig	51..141	CDD:299845
		IG_like	51..137	CDD:214653
		IG_like	153..237	CDD:214653	32/86 (37%)
		Ig	161..224	CDD:299845	27/65 (42%)
		IG_like	252..335	CDD:214653	6/16 (38%)
		Ig	258..333	CDD:143165	3/10 (30%)
Lrit1	NP_666357.2	LRRNT	23..61	CDD:214470
		LRR 1	60..81
		LRR_8	63..143	CDD:290566
		leucine-rich repeat	64..84	CDD:275378
		LRR 2	84..105
		leucine-rich repeat	85..132	CDD:275378
		LRR 3	108..129
		LRR_8	131..>176	CDD:290566
		LRR_4	131..172	CDD:289563
		LRR 4	132..153
		leucine-rich repeat	133..156	CDD:275378
		LRR 5	156..177
		leucine-rich repeat	157..180	CDD:275378
		leucine-rich repeat	181..205	CDD:275378
		TPKR_C2	201..>241	CDD:301599
		Ig	258..346	CDD:299845	33/88 (38%)
		IG_like	268..346	CDD:214653	31/79 (39%)
		FN3	432..502	CDD:214495
		LRR 6	526..549
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900