DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Iglon5

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:350 Identity:107/350 - (30%)
Similarity:166/350 - (47%) Gaps:41/350 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKQTCALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYK 73
            |.:..|.:.:..|.::|:....|.:|          ||||..|.|...|.:|.|:|.: |....:
Mouse     9 RLRLLAAAALAGLAVISRGLLSQSLE----------FSSPADNYTVCEGDNATLSCFI-DEHVTR 62

  Fly    74 VAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINT--DPMKSQM 136
            ||||  :...||...|...|.:.|:.:..:..:.:::.|..:...|:|.|.|...|  .|..:|:
Mouse    63 VAWL--NRSNILYAGNDRWTSDPRVRLLINTPEEFSILITQVGLGDEGLYTCSFQTRHQPYTTQV 125

  Fly   137 GYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELATGEEVMSIEG 201
             ||.|.||..|::  .|:.:.|.||.||.|.|.|.|.||||:|||       :|..|   .:.||
Mouse   126 -YLIVHVPARIVN--ISSPVAVNEGGNVNLLCLAVGRPEPTVTWR-------QLRDG---FTSEG 177

  Fly   202 TDLVIPNVRRHHMGAYLCIASNGVPPSV-SKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESE 265
            ..|.|.:::|...|.|.|:..|||..:. |:|:.:.|::||.||.......|: |:...|.||:.
Mouse   178 EILEISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTAL-GRAALLRCEAM 241

  Fly   266 AYPKSINYWTRERGEIVPPGGKYSANV-TEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTD 329
            |.|.:...|.:: ..::..|......| ||   ...||.|..| ::...:|:|.|.|.|.||.:.
Mouse   242 AVPPADFQWYKD-DRLLSSGSAEGLKVQTE---RTRSMLLFAN-VSARHYGNYTCRAANRLGASS 301

  Fly   330 GTIKLYRIPPNAVNYVENFEARHKG 354
            .:::|.|  |.:   :||...|..|
Mouse   302 ASMRLLR--PGS---LENSAPRPPG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 26/91 (29%)
IG_like 51..137 CDD:214653 24/87 (28%)
IG_like 153..237 CDD:214653 32/84 (38%)
Ig 161..224 CDD:299845 24/62 (39%)
IG_like 252..335 CDD:214653 23/83 (28%)
Ig 258..333 CDD:143165 21/75 (28%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 26/91 (29%)
Ig strand A' 41..46 CDD:409353 2/4 (50%)
Ig strand B 48..56 CDD:409353 3/7 (43%)
CDR1 56..60 CDD:409353 1/4 (25%)
FR2 61..68 CDD:409353 4/8 (50%)
Ig strand C 61..67 CDD:409353 4/7 (57%)
CDR2 69..79 CDD:409353 3/9 (33%)
Ig strand C' 71..74 CDD:409353 2/2 (100%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 7/34 (21%)
Ig strand D 84..91 CDD:409353 1/6 (17%)
Ig strand E 94..100 CDD:409353 0/5 (0%)
Ig strand F 107..115 CDD:409353 3/7 (43%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 4/9 (44%)
FR4 122..129 CDD:409353 3/7 (43%)
Ig strand A 132..137 CDD:409353 2/4 (50%)
Ig_3 134..199 CDD:404760 28/76 (37%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 4/8 (50%)
Ig strand C 163..167 CDD:409353 2/3 (67%)
Ig strand D 174..177 CDD:409353 0/2 (0%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 3/7 (43%)
Ig_3 217..295 CDD:404760 24/83 (29%)
putative Ig strand A 218..224 CDD:409353 3/5 (60%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/3 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 2/4 (50%)
Ig strand G 301..304 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833622
Domainoid 1 1.000 59 1.000 Domainoid score I10599
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.