DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and zig-8

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:264 Identity:62/264 - (23%)
Similarity:101/264 - (38%) Gaps:58/264 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SNFCQCRKQTCALSVILLLILMS---------QQCYPQ---RVEVPAEVIVDPKFSSPIVNMTAP 55
            ||.|          |||...|.:         ..|..|   |||.|::.||:....:|       
 Worm     5 SNIC----------VILFSFLYATGHGASEEVMACLRQERSRVENPSQTIVNVVAENP------- 52

  Fly    56 VGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDK 120
                |:|.|.|.....:::||.||....:||..|...|::.|..::......|.:.::..::.|.
 Worm    53 ----AYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKKSANIWVLNLRRAEQQDS 113

  Fly   121 GWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTD------MVVREGSNVTLKCAATGSPEP--- 176
            |.|:|:||.........||.|:.||  |..|:|..      |....|..|.|.|..|.:.:.   
 Worm   114 GCYLCEINDKHNTVYAVYLKVLEPP--LPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEV 176

  Fly   177 -TITWRRESGVPIELATGEEVMSIE---GTDLVIPNVRRHHM---GAYLCIASNGVPPSVSKRIT 234
             .:.|.|:........|.:.::.::   |..:....:|:..|   |.|.|..|       .::.:
 Worm   177 LDVVWTRDGNTINFNDTEKYILKVKRDAGVVIETMRIRKATMEDDGNYACEHS-------QQKAS 234

  Fly   235 LVVH 238
            .:||
 Worm   235 QIVH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 22/89 (25%)
IG_like 51..137 CDD:214653 20/85 (24%)
IG_like 153..237 CDD:214653 17/99 (17%)
Ig 161..224 CDD:299845 15/72 (21%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
zig-8NP_499714.1 IG_like 55..134 CDD:214653 21/78 (27%)
Ig 55..129 CDD:143165 19/73 (26%)
ig 158..229 CDD:278476 14/70 (20%)
IG_like 158..227 CDD:214653 13/68 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.