DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and EMB

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_940851.1 Gene:EMB / 133418 HGNCID:30465 Length:327 Species:Homo sapiens


Alignment Length:290 Identity:72/290 - (24%)
Similarity:110/290 - (37%) Gaps:62/290 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 PTSTDMVVREGSNVTLKCAATGSPE---PTITWRRESGVPIE-----LATGEEVMSIEGTDLVIP 207
            |...::.:...|||.|.|..|.|.:   ..:||::: |..:|     .|||..:.    |.....
Human    71 PVEKNITLERPSNVNLTCQFTTSGDLNAVNVTWKKD-GEQLENNYLVSATGSTLY----TQYRFT 130

  Fly   208 NVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESE-AYPKSI 271
            .:....||:|.|....    ...:|.|.....|.:......||..| |....|.|:.: .:|  :
Human   131 IINSKQMGSYSCFFRE----EKEQRGTFNFKVPELHGKNKPLISYV-GDSTVLTCKCQNCFP--L 188

  Fly   272 NY-WTRERGEIVPPGG----KYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGT 331
            |: |....|.:..|.|    ||..|    |.|.|..:|.|..|.:.:..||.|.|...||:::..
Human   189 NWTWYSSNGSVKVPVGVQMNKYVIN----GTYANETKLKITQLLEEDGESYWCRALFQLGESEEH 249

  Fly   332 IKL----YRIP--PNAVNYVENFE--------ARHKGKKRTKSSESHHPARAQEHSGEDMENPGK 382
            |:|    |.:|  |..|...|...        .::..||:..|.|           |::.|...:
Human   250 IELVVLSYLVPLKPFLVIVAEVILLVATILLCEKYTQKKKKHSDE-----------GKEFEQIEQ 303

  Fly   383 RKADLSLGAESIDSIYGNSAAGSRRRQDLG 412
            .|:|.|.|.|       |:....|:.:.||
Human   304 LKSDDSNGIE-------NNVPRHRKNESLG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845
IG_like 51..137 CDD:214653
IG_like 153..237 CDD:214653 21/91 (23%)
Ig 161..224 CDD:299845 19/70 (27%)
IG_like 252..335 CDD:214653 27/92 (29%)
Ig 258..333 CDD:143165 23/80 (29%)
EMBNP_940851.1 Ig 82..143 CDD:325142 18/65 (28%)
IG_like 172..254 CDD:214653 27/88 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327 15/58 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.