DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and AgaP_AGAP009247

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_320023.4 Gene:AgaP_AGAP009247 / 1280200 VectorBaseID:AGAP009247 Length:251 Species:Anopheles gambiae


Alignment Length:236 Identity:71/236 - (30%)
Similarity:105/236 - (44%) Gaps:41/236 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PKFS-SPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRI-GIANSEH 105
            |.|. |...|:||.||:.|:|.|.|:::|...|:|:|.....:||:.....|.:||. .:.|.:.
Mosquito    42 PHFDLSASKNITALVGKTAYLNCRVKNIGNKTVSWVRHRDIHLLTVGRFTYTSDQRFQAVHNPQT 106

  Fly   106 KTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVP-PDILDYPTSTDMVVREGSNVTLKCA 169
            ..|:::|:..::.|.|.|.|||:|.|......:|.||.| ..|:..|   |:.:..||.|.|.|.
Mosquito   107 DDWSLQIRYPQKRDTGVYECQISTTPPVGHSMFLAVVEPITTIVGVP---DLYINTGSTVNLTCI 168

  Fly   170 ATGSPEP--TITWRRES----------GVPIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIAS 222
            ...||||  ||.|...:          ||.:....||...|.    |:|...|....|.|:|..|
Mosquito   169 VRNSPEPPSTIFWTHNNQEINYDSPRGGVSVITEKGETTTSY----LLIQRARTTDSGKYVCSPS 229

  Fly   223 NGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCE 263
            |..|.:::      ||.             :.|..:||.|:
Mosquito   230 NADPSTIN------VHI-------------LNGTVLTLPCQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 30/90 (33%)
IG_like 51..137 CDD:214653 29/86 (34%)
IG_like 153..237 CDD:214653 27/95 (28%)
Ig 161..224 CDD:299845 24/74 (32%)
IG_like 252..335 CDD:214653 4/12 (33%)
Ig 258..333 CDD:143165 3/6 (50%)
AgaP_AGAP009247XP_320023.4 IG_like 49..137 CDD:214653 29/87 (33%)
Ig 52..133 CDD:299845 27/80 (34%)
IG_like 153..240 CDD:214653 29/99 (29%)
IGc2 160..231 CDD:197706 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.