DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Bsg

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_033898.1 Gene:Bsg / 12215 MGIID:88208 Length:389 Species:Mus musculus


Alignment Length:257 Identity:64/257 - (24%)
Similarity:99/257 - (38%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGS 162
            |..|..:|...::.:..:...|.|.|.|:.::||.::.:     ..||.:........:||.|..
Mouse    81 IHAAYRQHAASSLSVDGLTAEDTGTYECRASSD
PDRNHL-----TRPPRVKWVRAQASVVVLEPG 140

  Fly   163 NVTLKCAATGSPEPTITWRRESGVPI---ELATGEEVMSIEGTDLVIPNVRRHHM-------GAY 217
            .:........|..........|||.|   ....|.:|:. |.|   :|::...::       |.|
Mouse   141 TIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQ-EDT---LPDLHTKYIVDADDRSGEY 201

  Fly   218 LCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEA-YPKSIN-YW--TRER 278
            .||.   :|..|. |..:.|..||.|.|..:...:.||:...|.|:|:| ||...: :|  |.:.
Mouse   202 SCIF---LPEPVG-RSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDT 262

  Fly   279 GE------IVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKL 334
            ||      .....|||....|..........|.:|    .:.|:|.|.|.|:.|.|..||.|
Mouse   263 GEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVN----VDPGTYVCNATNAQGTTRETISL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 9/42 (21%)
IG_like 51..137 CDD:214653 9/38 (24%)
IG_like 153..237 CDD:214653 20/93 (22%)
Ig 161..224 CDD:299845 14/72 (19%)
IG_like 252..335 CDD:214653 28/93 (30%)
Ig 258..333 CDD:143165 24/84 (29%)
BsgNP_033898.1 ig 27..111 CDD:278476 7/29 (24%)
IG_like 29..113 CDD:214653 7/31 (23%)
IG_like 233..322 CDD:214653 28/92 (30%)
Ig 238..319 CDD:143165 24/84 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..389
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.