DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and JAML

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_016872702.1 Gene:JAML / 120425 HGNCID:19084 Length:416 Species:Homo sapiens


Alignment Length:306 Identity:60/306 - (19%)
Similarity:104/306 - (33%) Gaps:100/306 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQ---DLGPYKV 74
            |.|.:|||.:|:....          .:.|...|.|  .:|..||..|.:.||.|   |...:|:
Human    25 CPLKLILLPVLLDYSL----------GLNDLNVSPP--ELTVHVGDSALMGCVFQSTEDKCIFKI 77

  Fly    75 AWLRVDTQTILTIQNHV-------ITKNQRIGIANSEHKTWTM----------RIKDIKESDKGW 122
            .|       .|:...|.       ...|..:.|...:::...|          .::|::|:|:|.
Human    78 DW-------TLSPGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGT 135

  Fly   123 YMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTIT---W---- 180
            |:|:|.... :||: :...||...:.:.|  .:::|..|..:.:.|....:....:|   |    
Human   136 YICEIRLKG-ESQV-FKKAVVLHVLPEEP--KELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSG 196

  Fly   181 RRESGVPIELATGEEV---------MSIEGT---------------------DLVIPNVRRHHMG 215
            ||..         ||:         ||:|.:                     .:::..||....|
Human   197 RRAK---------EEIVFRYYHKLRMSVEYSQSWGHFQNRVNLVGDIFRNDGSIMLQGVRESDGG 252

  Fly   216 AYLCIASNG-----------VPPSVSKRITLVVHFPPMITVQNQLI 250
            .|.|....|           |.|...:.:.......|::...|||:
Human   253 NYTCSIHLGNLVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 24/109 (22%)
IG_like 51..137 CDD:214653 24/105 (23%)
IG_like 153..237 CDD:214653 20/131 (15%)
Ig 161..224 CDD:299845 16/99 (16%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
JAMLXP_016872702.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.