DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Opcml

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:339 Identity:107/339 - (31%)
Similarity:168/339 - (49%) Gaps:43/339 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALSVILLLILMSQQCYPQRVEVPAEVIV---DPKFSSPIVNMTAPVGRDAFLTCVVQDLGPYKV 74
            |.:.|.|.|:.:          ||..|.|   |..|...:.|:|...|..|.|.|.:.| ...:|
  Rat    13 CLVVVSLRLLFL----------VPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDD-RVTRV 66

  Fly    75 AWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTD--PMKSQMG 137
            |||  :..|||...|...:.:.|:.|..:....:::.|:::...|:|.|.|.:.||  |..|:: 
  Rat    67 AWL--NRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRV- 128

  Fly   138 YLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELATGEEVMSIEGT 202
            :|.|.|||.|::  .|:|:.|.|||:|||.|.|.|.||||:|||.     :.:..|:..:| |..
  Rat   129 HLIVQVPPQIMN--ISSDITVNEGSSVTLLCLAIGRPEPTVTWRH-----LSVKEGQGFVS-EDE 185

  Fly   203 DLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESEAY 267
            .|.|.:::|...|.|.|.|.|.|.....:::.:.|::||.|:.......:|..||: |.||:.|.
  Rat   186 YLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGI-LSCEASAV 249

  Fly   268 PKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLT-----QAEFGSYRCVAKNSLGD 327
            |.:...|.:|...:          .|.:.|.|...:..|:.||     :.::|:|.|||.|.||:
  Rat   250 PMAEFQWFKEDTRL----------ATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGN 304

  Fly   328 TDGTIKLYRIPPNA 341
            |:.:|.||.|.|::
  Rat   305 TNASITLYEISPSS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 27/91 (30%)
IG_like 51..137 CDD:214653 26/87 (30%)
IG_like 153..237 CDD:214653 31/83 (37%)
Ig 161..224 CDD:299845 25/62 (40%)
IG_like 252..335 CDD:214653 26/87 (30%)
Ig 258..333 CDD:143165 22/79 (28%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 27/91 (30%)
Ig strand A' 44..49 CDD:409353 2/4 (50%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 1/4 (25%)
FR2 64..70 CDD:409353 4/7 (57%)
Ig strand C 64..70 CDD:409353 4/7 (57%)
CDR2 71..83 CDD:409353 4/11 (36%)
Ig strand C' 72..76 CDD:409353 2/3 (67%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 7/33 (21%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 2/3 (67%)
Ig strand G 123..132 CDD:409353 3/9 (33%)
FR4 125..132 CDD:409353 2/7 (29%)
Ig_3 135..206 CDD:404760 32/78 (41%)
Ig strand A 135..138 CDD:409353 2/2 (100%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 5/8 (63%)
Ig strand C 165..170 CDD:409353 3/4 (75%)
Ig strand C' 171..174 CDD:409353 0/7 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig_3 223..300 CDD:404760 24/87 (28%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 2/4 (50%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337200
Domainoid 1 1.000 59 1.000 Domainoid score I10374
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4382
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8971
orthoMCL 1 0.900 - - OOG6_104123
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.700

Return to query results.
Submit another query.