DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and Emb

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_446171.1 Gene:Emb / 114511 RGDID:621067 Length:328 Species:Rattus norvegicus


Alignment Length:266 Identity:55/266 - (20%)
Similarity:100/266 - (37%) Gaps:50/266 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 DMVVREGSNVTLKCAATGSPE---PTITWRRESGVPIELATGEEVMSIEGTDLVIPNVR-----R 211
            ::.:...|::.|:|..|.:.:   ..:||:::..:   |.|.:...:.:..|.:....|     .
  Rat    75 NITLERPSHLELECTFTATEDVMSMNVTWKKDDAL---LETTDGFNTTKMGDTLYSQYRFTVFNS 136

  Fly   212 HHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDCESE-AYPKSINY-W 274
            ..||.|.|.....:..:.:.|:       |.:..:|:.:....|....|.||.: ..|  :|: |
  Rat   137 KQMGKYSCFLGEELRGTFNIRV-------PKVHGKNKPLITYVGDSTVLKCECQNCLP--LNWTW 192

  Fly   275 TRERGEIVPP-----GGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKL 334
            ....|....|     ..|:..|    |.|.|..:|.:..|.:.:.|||.|.|...||:::..|||
  Rat   193 YMSNGTAQVPIDVHVNDKFDIN----GSYANETKLKVKHLLEEDGGSYWCRAAFPLGESEEHIKL 253

  Fly   335 ----YRIPPN-----------AVNYVENFEARHKGKKRT----KSSESHHPARAQEHSGEDMENP 380
                :.:|..           .|..:...|...:.||..    |..|.....::.:.:|.:...|
  Rat   254 VVLSFMVPLKPFLAIIAEVILLVAIILLCEVYTQKKKNDPDDGKEFEQIEQLKSDDSNGIENNVP 318

  Fly   381 GKRKAD 386
            ..||.|
  Rat   319 RYRKTD 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845
IG_like 51..137 CDD:214653
IG_like 153..237 CDD:214653 15/89 (17%)
Ig 161..224 CDD:299845 14/70 (20%)
IG_like 252..335 CDD:214653 26/93 (28%)
Ig 258..333 CDD:143165 22/81 (27%)
EmbNP_446171.1 I-set 84..144 CDD:254352 12/62 (19%)
IG_like 172..255 CDD:214653 26/88 (30%)
Ig 177..252 CDD:143165 22/80 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..328 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.