DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and pigrl4.2

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001293038.1 Gene:pigrl4.2 / 105665605 ZFINID:ZDB-GENE-150409-10 Length:240 Species:Danio rerio


Alignment Length:108 Identity:24/108 - (22%)
Similarity:43/108 - (39%) Gaps:21/108 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GRDAFLTCVVQDLGPYKV-AWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDK 120
            |.|..:.|..:.....|: .|.|:|..|....:....::|..:.|::....::|:.:..::.||.
Zfish   136 GDDVSVRCFYRSAYQNKLKQWCRIDDLTCFREKKTDTSQNSSVQISDDGESSFTVLMTGLRLSDS 200

  Fly   121 GWYMCQINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSN 163
            |||.|.:         |.|.|.|           .:.|.:|.|
Zfish   201 GWYFCSV---------GNLQVPV-----------QLTV
YQGEN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 19/84 (23%)
IG_like 51..137 CDD:214653 17/80 (21%)
IG_like 153..237 CDD:214653 3/11 (27%)
Ig 161..224 CDD:299845 2/3 (67%)
IG_like 252..335 CDD:214653
Ig 258..333 CDD:143165
pigrl4.2NP_001293038.1 IG_like 26..118 CDD:214653
Ig_pIgR 30..117 CDD:143193
Ig 133..217 CDD:299845 21/100 (21%)
IG_like 136..218 CDD:214653 21/101 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.