DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and adgrl1.1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_002660669.2 Gene:adgrl1.1 / 100334775 ZFINID:ZDB-GENE-130116-2 Length:390 Species:Danio rerio


Alignment Length:224 Identity:48/224 - (21%)
Similarity:74/224 - (33%) Gaps:57/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 LCIASNGV---PPSVSKRITLVVHFPPMIT------------VQNQLIGAVEGKGVTLDCESEAY 267
            :|....||   |.:.:.|:...|.|...:|            :.||.:|.....| ||....|  
Zfish    18 VCAQGPGVSVRPRTAAVRLGETVSFQHRVTSRAQPGMLESGKMNNQTLGVFVCPG-TLVRVLE-- 79

  Fly   268 PKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQ------AEFGSYRCVAKNSLG 326
            |.|:.       |.....|.:..:..:.|.     ||::.|.|.      .|:.|:....:|.:.
Zfish    80 PSSVR-------EAEDHSGAWCKDPLQAGD-----RLYVMPWTPYRTDMLYEYASWDDYIQNRVT 132

  Fly   327 DTDGTIKLYRIPP--NAVNYVENFEARHKGKKRT------------KSSESHHPARAQEHSGEDM 377
            .|      |::|.  :...:|....|....|:||            ||.|: ....|..|.....
Zfish   133 TT------YKLPSRVDGTGFVVYDGAVFYNKERTRNIVKYDLRTRIKSGEA-VIVNANYHDASPY 190

  Fly   378 ENPGKRKADLSLGAESIDSIYGNSAAGSR 406
            ...||...||::....:..||...|...|
Zfish   191 HRGGKSDIDLAVDEHGLWVIYTTEANNGR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845
IG_like 51..137 CDD:214653
IG_like 153..237 CDD:214653 5/21 (24%)
Ig 161..224 CDD:299845 1/5 (20%)
IG_like 252..335 CDD:214653 17/88 (19%)
Ig 258..333 CDD:143165 16/80 (20%)
adgrl1.1XP_002660669.2 OLF 72..328 CDD:295358 37/170 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.