DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and si:ch211-9d9.7

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_021322083.1 Gene:si:ch211-9d9.7 / 100150985 ZFINID:ZDB-GENE-060503-422 Length:288 Species:Danio rerio


Alignment Length:208 Identity:47/208 - (22%)
Similarity:88/208 - (42%) Gaps:18/208 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VITKNQRIG--IANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQMGYLDVV------VPPDI 147
            ||.:.|.|.  |::....::|:.:.::..||..|:.|......:..|:....|:      :..:.
Zfish     4 VIGEIQHIPEFISDDGKSSFTVLMTELTLSDSEWFFCSAGDLQVPVQLTVTKVIFVCCFCLGVES 68

  Fly   148 LDYPTSTDMVVREGSNVTLKC-AATGSPEPTITWRRESGVPIELA-TGEEVMS-IEGTD-----L 204
            .:..::..:.|:.|.:||:.| ....:|.....|....|...:.. |.||.:| |:..|     :
Zfish    69 FEGGSNHTITVKPGGSVTIPCYYDEKNPPQKKYWYSVIGESRKYTNTTEENLSVIDHPDQSLFTV 133

  Fly   205 VIPNVRRH-HMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVEGKGVTLDC-ESEAY 267
            .:.|::.: |.|.|.|....|...:|:..:.|.||..|.::|.|..:...||..|::.| .|..|
Zfish   134 TMRNLQENKHNGKYYCTVETGQKSNVTYELFLQVHSAPDVSVMNSSVSGHEGDDVSVQCFYSSGY 198

  Fly   268 PKSINYWTRERGE 280
            ......|.|.:.:
Zfish   199 KDKQKRWCRYKDQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 11/51 (22%)
IG_like 51..137 CDD:214653 11/47 (23%)
IG_like 153..237 CDD:214653 22/92 (24%)
Ig 161..224 CDD:299845 18/71 (25%)
IG_like 252..335 CDD:214653 8/30 (27%)
Ig 258..333 CDD:143165 6/24 (25%)
si:ch211-9d9.7XP_021322083.1 Ig 76..168 CDD:325142 22/91 (24%)
Ig 180..266 CDD:325142 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.