DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and si:ch211-141e20.2

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_009302934.1 Gene:si:ch211-141e20.2 / 100150732 ZFINID:ZDB-GENE-070912-75 Length:424 Species:Danio rerio


Alignment Length:368 Identity:70/368 - (19%)
Similarity:127/368 - (34%) Gaps:72/368 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKQTCALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAFLTCVVQD----- 68
            |.:|..|..:..||     |    |.:..|.::..       :.....|..|.|.|.:.|     
Zfish    20 RSKTVILLFVYFLI-----C----VRISGEEVIGH-------DTAVEYGERANLLCHLTDTKEDI 68

  Fly    69 -LGPYKVAWLRVDTQTILTI------QNHVITKNQRIG-IANSEHKTWTMRIKDIKESDKGWYMC 125
             |..:|....|...:.|..:      ..|:.....|:. |.:...:..:::::.::..|:|.|.|
Zfish    69 TLIMWKKTTKRKTEEDIFFVIHQDDKTEHINGLGDRVQFIGSFAERNGSIQLRGMEFLDEGTYTC 133

  Fly   126 QINTDPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKC---------AATGSPEPTITWR 181
            ..|..|    .|.:...:...:...|.    |..:|....:.|         |:...|...:|||
Zfish   134 IFNLFP----SGPIATYIKASVFARPA----VTVKGEEPVIGCLEVILASCFASNARPAAEVTWR 190

  Fly   182 -RESGVPIELATGEEVMSIEGTDLV-----IPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFP 240
             .|....::..|...|.:.|...:|     :|....|.......:..|.:...:....|:.:|:|
Zfish   191 LGELEKSLKTRTNHTVNANETITVVSYLLGVPFKHLHKKNIQCVVKHNSLTEHLVLNYTIDIHYP 255

  Fly   241 P--MITVQNQLIGAVEGKGVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMR 303
            |  :|.:.:......|.:.: :|...:...|..| |||               |.:...:....|
Zfish   256 PESVIIIPDSSTDVNEFRCI-VDSNPQPTLKGYN-WTR---------------VNKSSQFFEGNR 303

  Fly   304 LHINPLTQAEFGSYRCVAKNSLGDTDGTIKL-YRIPPNAVNYV 345
            |.:..:|....|.|.|.|.|..|...|::.: ....|::|.:|
Zfish   304 LPVPNMTPELNGLYICNASNKYGSALGSLYVNVHAEPSSVCWV 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 19/102 (19%)
IG_like 51..137 CDD:214653 18/98 (18%)
IG_like 153..237 CDD:214653 17/98 (17%)
Ig 161..224 CDD:299845 14/77 (18%)
IG_like 252..335 CDD:214653 18/83 (22%)
Ig 258..333 CDD:143165 17/74 (23%)
si:ch211-141e20.2XP_009302934.1 Ig 52..143 CDD:325142 19/94 (20%)
Ig 163..250 CDD:325142 14/86 (16%)
Ig 271..336 CDD:325142 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.