DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DIP-eta and negr1

DIOPT Version :9

Sequence 1:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:380 Identity:118/380 - (31%)
Similarity:183/380 - (48%) Gaps:43/380 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQSNFCQCRKQTCALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIV-NMTAPVGRDAFLTC 64
            :|...| |..|..| :|||.|..:...|      :||...:|  |..|.| |:....|..|.|.|
 Frog     7 VQGAAC-CSNQWLA-AVILSLCCLLPSC------LPAGQSMD--FQWPAVDNLVVRQGETAMLRC 61

  Fly    65 VVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINT 129
            .::: |..|.|||  :..:|:.......:.:.|:.||.|..:.:::||:.:..||.|.|.|.:.|
 Frog    62 FLEE-GASKGAWL--NRSSIIFAGGDKWSVDPRVSIATSSKQEYSLRIQKVDVSDDGPYTCSVQT 123

  Fly   130 D--PMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGSPEPTITWRRESGVPIELAT 192
            :  |...|: :|.|.|.|.|  |..|:||.|.||:||:|.|.|||.|||:|:||..|....:..:
 Frog   124 EHSPRTLQV-HLTVHVSPKI--YDISSDMTVNEGTNVSLICLATGKPEPSISWRHISPSAKQFGS 185

  Fly   193 GEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVP-PSVSKRITLVVHFPPMITVQNQLIGAVEGK 256
            |:.        |.|..:.|...|.|.|.|.|.|. |.| |::.:.|:|.|.| ::....|...|:
 Frog   186 GQY--------LDIYGITRDQAGDYECSAENDVSFPDV-KKVKVTVNFAPTI-LEITPTGVSLGR 240

  Fly   257 GVTLDCESEAYPKSINYWTRERGEIVPPGGKYSANVTEIGGYRNSMRLHINPLTQAEFGSYRCVA 321
            ...:.||:.|.|..:..|  .:||.....|:..   ..|..|.....|.::.:|:..||:|.|||
 Frog   241 TGLIRCETAAVPAPVFEW--YKGEKKLTNGQRG---IRIQNYNTRSILTVSNVTEEHFGNYTCVA 300

  Fly   322 KNSLGDTDGTIKLYR-IPPNAVNYVEN---FEARHKGKKRTKSSESHH--PARAQ 370
            .|.||.::.::.|.: |.|:..:.|.:   :..:|..  |:.|.:.|:  |:.||
 Frog   301 VNKLGTSNASLPLNQIIEPSTTSPVTSSAKYSVKHYA--RSSSDKPHYAAPSTAQ 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 26/91 (29%)
IG_like 51..137 CDD:214653 25/87 (29%)
IG_like 153..237 CDD:214653 33/84 (39%)
Ig 161..224 CDD:299845 23/62 (37%)
IG_like 252..335 CDD:214653 22/82 (27%)
Ig 258..333 CDD:143165 21/74 (28%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 28/95 (29%)
FR1 44..62 CDD:409353 6/17 (35%)
Ig strand A' 47..53 CDD:409353 1/5 (20%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 1/5 (20%)
FR2 69..75 CDD:409353 4/7 (57%)
Ig strand C 69..74 CDD:409353 4/6 (67%)
CDR2 76..87 CDD:409353 1/10 (10%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 11/33 (33%)
Ig strand D 91..98 CDD:409353 3/6 (50%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 3/9 (33%)
FR4 129..136 CDD:409353 2/7 (29%)
Ig_3 140..208 CDD:404760 31/77 (40%)
Ig strand A' 146..151 CDD:409353 3/4 (75%)
Ig strand B 157..164 CDD:409353 3/6 (50%)
Ig strand C 170..175 CDD:409353 2/4 (50%)
Ig strand C' 177..179 CDD:409353 1/1 (100%)
Ig strand E 187..193 CDD:409353 2/13 (15%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 2/8 (25%)
Ig_3 226..302 CDD:404760 22/81 (27%)
putative Ig strand A 226..232 CDD:409353 2/6 (33%)
Ig strand B 242..246 CDD:409353 0/3 (0%)
Ig strand C 255..259 CDD:409353 1/5 (20%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4412
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.