| Sequence 1: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031751462.1 | Gene: | lsamp / 100124984 | XenbaseID: | XB-GENE-5759171 | Length: | 368 | Species: | Xenopus tropicalis |
| Alignment Length: | 305 | Identity: | 102/305 - (33%) |
|---|---|---|---|
| Similarity: | 147/305 - (48%) | Gaps: | 29/305 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 FSSPIVNMTAPVGRDAFLTCVVQDLGPYKVAWLRVDTQTILTIQNHVITKNQRIGIANSEHKTWT 109
Fly 110 MRIKDIKESDKGWYMCQINT-DPMKSQMGYLDVVVPPDILDYPTSTDMVVREGSNVTLKCAATGS 173
Fly 174 PEPTITWRR---ESGV-PIELATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRIT 234
Fly 235 LVVHFPPMITVQNQLIGAVEGKGVTLDCESEAYPKSINYW----TRERGEIVPPGGKYSANVTEI 295
Fly 296 GGYRNSMRLHINPLTQAEFGSYRCVAKNSLGDTDGTIKLY-RIPP 339 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 25/90 (28%) |
| IG_like | 51..137 | CDD:214653 | 23/86 (27%) | ||
| IG_like | 153..237 | CDD:214653 | 35/87 (40%) | ||
| Ig | 161..224 | CDD:299845 | 28/66 (42%) | ||
| IG_like | 252..335 | CDD:214653 | 27/86 (31%) | ||
| Ig | 258..333 | CDD:143165 | 24/78 (31%) | ||
| lsamp | XP_031751462.1 | Ig | 38..128 | CDD:416386 | 25/92 (27%) |
| FR1 | 38..54 | CDD:409353 | 5/15 (33%) | ||
| Ig strand A' | 39..45 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 47..55 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 55..59 | CDD:409353 | 2/3 (67%) | ||
| FR2 | 60..67 | CDD:409353 | 4/9 (44%) | ||
| Ig strand C | 60..66 | CDD:409353 | 4/8 (50%) | ||
| CDR2 | 68..78 | CDD:409353 | 1/9 (11%) | ||
| Ig strand C' | 70..73 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 75..78 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 79..114 | CDD:409353 | 8/34 (24%) | ||
| Ig strand D | 83..90 | CDD:409353 | 1/6 (17%) | ||
| Ig strand E | 93..99 | CDD:409353 | 1/5 (20%) | ||
| Ig strand F | 106..114 | CDD:409353 | 3/7 (43%) | ||
| CDR3 | 115..119 | CDD:409353 | 1/3 (33%) | ||
| Ig strand G | 119..128 | CDD:409353 | 3/8 (38%) | ||
| FR4 | 121..128 | CDD:409353 | 2/6 (33%) | ||
| Ig_3 | 131..206 | CDD:404760 | 35/82 (43%) | ||
| Ig strand A' | 138..143 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 149..156 | CDD:409353 | 4/6 (67%) | ||
| Ig strand C | 162..167 | CDD:409353 | 3/4 (75%) | ||
| Ig strand C' | 173..175 | CDD:409353 | 1/1 (100%) | ||
| Ig strand E | 185..191 | CDD:409353 | 2/11 (18%) | ||
| Ig strand F | 198..205 | CDD:409353 | 3/6 (50%) | ||
| Ig strand G | 212..220 | CDD:409353 | 1/7 (14%) | ||
| Ig_3 | 223..302 | CDD:404760 | 27/86 (31%) | ||
| putative Ig strand A | 224..230 | CDD:409353 | 3/6 (50%) | ||
| Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 281..285 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 295..300 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 308..311 | CDD:409353 | 0/2 (0%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 58 | 1.000 | Domainoid score | I10578 |
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 138 | 1.000 | Inparanoid score | I4412 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D265311at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000150 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X97 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 5.060 | |||||