DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14011 and Ccdc34

DIOPT Version :9

Sequence 1:NP_608943.1 Gene:CG14011 / 33790 FlyBaseID:FBgn0031722 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_080889.3 Gene:Ccdc34 / 68201 MGIID:1915451 Length:367 Species:Mus musculus


Alignment Length:299 Identity:74/299 - (24%)
Similarity:126/299 - (42%) Gaps:52/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GELG-EDIELQTESETVCLHLGSPSSSTSTDR--SSCSSRSCPSSRSGNNSSDKDSTTSMCSWEE 177
            |:.| ||:.|     |.||...|.|.|.||..  |....:|.|.....:...|          ||
Mouse    41 GDPGLEDVAL-----TECLSPPSLSCSNSTLSLLSPLGHQSFPFGADDSEGED----------EE 90

  Fly   178 AMSRD----DSMLAPLELPLSHSLPSLRLGSSVGSPPLTYTRRIEPLHIRRSAGEAYENWLSGKQ 238
            |:..|    :|.:..||........|..:.|......|..        ::..:...:|.|..||:
Mouse    91 ALDEDARESESKVESLEGIEFQQRSSCEVESQDKQEKLVL--------LQHGSLTPWEMWFVGKE 147

  Fly   239 RQCQYKLQA-------QQAEREAQRQRTELRQRLAKEKYEQWCQQKAQQTTS--TAKLTK--PDR 292
            ::.:.:||.       ||.|:..:.:..|.|:.:|:.|:::|.|:|.:|...  ..|:.|  .::
Mouse   148 KEERGRLQQKFLEELNQQIEKRKEMEEREKRKIIAEVKHKEWVQKKNKQERKEREQKINKEMEEK 212

  Fly   293 SAQLPPQKNM-ASVQHHLQEWELHKLRLLE-QRRLEQRNAERRRQEEKAARRSQAEEAFSRWMSN 355
            .|:...:::: ...:...||| |.|.:..| :::.:::..|::||.|...::..||:.|..|:.|
Mouse   213 EAKKREKEHLQEKAKEKYQEW-LKKKKAEEYEKKKKEKEKEKQRQAELQEKKEIAEKKFKEWLEN 276

  Fly   356 VAQRPKPVPSSQGMKS--LRGTVS------DIFINPKQW 386
            ...:|:|...|.|..|  |.|..|      ..|.||..|
Mouse   277 AKNKPRPAAKSYGYSSGKLTGFYSGNSYPEPTFYNPIPW 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14011NP_608943.1 DUF4207 160..386 CDD:290615 57/250 (23%)
Ccdc34NP_080889.3 DUF4207 63..315 CDD:290615 62/270 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..105 7/37 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..228 6/36 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 310..349 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847763
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29IGA
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.