DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14011 and Ccdc34

DIOPT Version :9

Sequence 1:NP_608943.1 Gene:CG14011 / 33790 FlyBaseID:FBgn0031722 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001382531.1 Gene:Ccdc34 / 362187 RGDID:1560583 Length:376 Species:Rattus norvegicus


Alignment Length:301 Identity:76/301 - (25%)
Similarity:132/301 - (43%) Gaps:50/301 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EGPRVGELGEDIELQTESETVCLHLGSPSSSTSTDR--SSCSSRSCPSSRSGNNSSDKDSTTSMC 173
            :||.:    ||:.|     |.||...|.|.|.||..  |....||.|.....:...|        
  Rat    41 QGPGL----EDVAL-----TECLLPPSLSCSNSTLSLLSPLGHRSFPFGEDDSEGED-------- 88

  Fly   174 SWEEAMSRDD-SMLAPLELPLSHSLPSLRL-GSSVGSPPLTYTRRIEPLHIRRSAGEAYENWLSG 236
              |||:..|. ...|.:|     ||..:.| |.|.........:..:.:.::.|:...:|.|..|
  Rat    89 --EEALDEDACESEAKVE-----SLEGMELQGRSSCEVESQDKQEEKQVLLQESSLTPWEMWFVG 146

  Fly   237 KQRQCQYKLQA-------QQAEREAQRQRTELRQRLAKEKYEQWCQQKAQQTTS--TAKLTK--P 290
            |:::.:.:||.       :|.|:..:.:..|.|:.:|:.|:::|.|:|.:|...  ..|:.|  .
  Rat   147 KEKEERGRLQQKVLEELNRQIEKRKEMEEREKRKIIAEVKHKEWVQKKNKQERKERVQKINKEME 211

  Fly   291 DRSAQLPPQKNM-ASVQHHLQEWELHKLRLLE-QRRLEQRNAERRRQEEKAARRSQAEEAFSRWM 353
            :::|:...:::: ...:...||| |.|.:..| :::.:::..|::||.|...::..||:.|..|:
  Rat   212 EKAAKKREKEHLQEKAKEKYQEW-LKKKKAEECEKKKKEKEKEKQRQAELQEKKEIAEKKFKEWL 275

  Fly   354 SNVAQRPKPVPSSQGMKS--LRGTVS------DIFINPKQW 386
            .|...:|:|...|.|..|  |.|..|      ..|.||..|
  Rat   276 ENAKNKPRPAAKSYGYSSGKLTGFYSGNSYPEPTFYNPIPW 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14011NP_608943.1 DUF4207 160..386 CDD:290615 58/248 (23%)
Ccdc34NP_001382531.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23247
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.