DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14011 and CG7251

DIOPT Version :9

Sequence 1:NP_608943.1 Gene:CG14011 / 33790 FlyBaseID:FBgn0031722 Length:388 Species:Drosophila melanogaster
Sequence 2:NP_001285630.1 Gene:CG7251 / 33791 FlyBaseID:FBgn0031723 Length:321 Species:Drosophila melanogaster


Alignment Length:317 Identity:97/317 - (30%)
Similarity:146/317 - (46%) Gaps:67/317 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IELQTE--SETVCLHLGSPSSSTSTDRSSCSSRSCPSSRSGNNSSD---KD-----STTSMCSWE 176
            |.|:.|  |...|: ..||||.     .|.:|.|.|||.:.|.:..   ||     |..|..:|.
  Fly    13 IVLRDEIFSSRTCI-ARSPSSG-----GSLNSMSSPSSLAQNTTRTYFFKDDGGNPSPQSTDNWS 71

  Fly   177 -EAMSRDDSMLAPLELPLSHSLPSLRLGSSVGSPPLTYTRRIEPLHIRRSAGEAYENWLSGKQRQ 240
             ..:.|.:..        |:.:|||.|.|...|  |.|....:.:.:.|....||:||.|.||:|
  Fly    72 LGGLKRSEIQ--------SNLVPSLCLSSQESS--LNYLSHCKGIKVDRQPEAAYQNWYSAKQQQ 126

  Fly   241 CQYKLQAQQAEREAQRQRTELRQRLAKEKYEQWCQQKAQQT---------------TSTAKLTKP 290
            ...|.:..:.|:|.::||||.|::||:..||||.:.||:|.               .|.|....|
  Fly   127 LLEKQRRIKEEQEFKQQRTEERKQLARMCYEQWLKDKARQAANLQLESHIQDAAMKASIALRKNP 191

  Fly   291 DRSAQLPPQKNMAS-------------------------VQHHLQEWELHKLRLLEQRRLEQRNA 330
            ..|.:..|..:..|                         ::..:::|.|.|....:.:|.|:|.|
  Fly   192 LESLRKNPVVSSLSGLGSLGSGPSSSTAPRRIRKVSKDEIRRVVEDWWLKKQSQQQAQREEKRRA 256

  Fly   331 ERRRQEEKAARRSQAEEAFSRWMSNVAQRPKPVPSSQGMKSLRGTVSDIFINPKQWV 387
            ...:..::..||..|::|:|:|||||..:|||||.:|||.|||||:|.:::||..|:
  Fly   257 MLSKALKEEQRRQLAQDAWSKWMSNVDAKPKPVPLNQGMDSLRGTISQLYVNPTPWM 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14011NP_608943.1 DUF4207 160..386 CDD:290615 81/274 (30%)
CG7251NP_001285630.1 DUF4207 45..312 CDD:290615 81/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466603
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29IGA
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014359
OrthoInspector 1 1.000 - - otm49571
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.