DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIB and Ir75b

DIOPT Version :10

Sequence 1:NP_523485.3 Gene:GluRIIB / 33789 FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster


Alignment Length:35 Identity:9/35 - (25%)
Similarity:15/35 - (42%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EPELAEKYGIRGYPTLKFFRSGSQVDYTGGREQDT 124
            :|..|.:....|..|||  :..:....|..|.::|
  Fly    19 KPTSAPRAAAGGSSTLK--QRKTTTTATAARNRNT 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..387 CDD:380605 9/35 (26%)
PBP2_iGluR_Kainate 422..795 CDD:270432
Ir75bNP_001137966.2 Lig_chan-Glu_bd <235..283 CDD:463166
Periplasmic_Binding_Protein_Type_2 <259..>325 CDD:473866
Lig_chan 343..584 CDD:459656
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.