DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIB and ZK867.2

DIOPT Version :9

Sequence 1:NP_523485.3 Gene:GluRIIB / 33789 FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_001355384.1 Gene:ZK867.2 / 191445 WormBaseID:WBGene00022829 Length:354 Species:Caenorhabditis elegans


Alignment Length:198 Identity:43/198 - (21%)
Similarity:72/198 - (36%) Gaps:58/198 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 NERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYG-SYDANTDE----WDGIIRQL-IDNNAQIGI 507
            |.:..|..|:::.|:.:....::....|. .|:| .||..:.:    |.|:|..| .|....||:
 Worm    23 NCKHPGAEVEILKMIFRLIGVNYTMIDVW-KKFGQQYDFGSKQKNGNWSGMIGLLQSDQLDMIGL 86

  Fly   508 CDLTITQARRSVVDFTVPFMQLGISILSYKEPPP---------------------KADIYAFLN- 550
             .:.|...|..||.|:.|......||.|:    |                     :.|:.|||: 
 Worm    87 -SMRIAPEREEVVLFSYPTRVFETSIQSF----PVSSRMLLLIILIATFFISQLYQTDMLAFLSV 146

  Fly   551 ------PYNAEVWLFVMI---AMMITAF-----------ALIFTGRIDQYEWDQPVENVNREMER 595
                  |:.:......::   .|.|.||           ..:|...||:    .||...|::.|.
 Worm   147 PLTYSIPFRSIKQALELVEHQKMYIAAFENQTLLCTPTTCSLFQKSIDK----NPVRRANKDTEV 207

  Fly   596 QNI 598
            |::
 Worm   208 QDL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377
ANF_receptor 41..378 CDD:279440
PBP2_iGluR_Kainate 422..795 CDD:270432 43/198 (22%)
Lig_chan 555..822 CDD:278489 12/58 (21%)
ZK867.2NP_001355384.1 Lig_chan-Glu_bd 22..77 CDD:214911 12/54 (22%)
Periplasmic_Binding_Protein_Type_2 <69..>103 CDD:389745 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.