DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIB and Grik1

DIOPT Version :10

Sequence 1:NP_523485.3 Gene:GluRIIB / 33789 FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:NP_001391957.1 Gene:Grik1 / 14805 MGIID:95814 Length:949 Species:Mus musculus


Alignment Length:91 Identity:23/91 - (25%)
Similarity:32/91 - (35%) Gaps:24/91 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 CGHCKQLV--PIYDKL--GEKYKDSDSVVIAKIDATANELEH-------------------TKIS 438
            |.....||  |.|.:|  |..:. .|.|||.|..:.|...||                   ..|:
Mouse   399 CSQVSSLVFAPNYKELVSGHGFA-HDKVVIWKYPSFAKVTEHEGHEARILNLALSPDGSTLASIA 462

  Fly   439 SFPTIYLYRKGDNEKVEFKGERTLEG 464
            :..||.|::..:.||...|..:...|
Mouse   463 ADETIRLWKCFEKEKDAAKKPKQASG 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..387 CDD:380605
PBP2_iGluR_Kainate 422..795 CDD:270432 13/62 (21%)
Grik1NP_001391957.1 PBP1_iGluR_Kainate 38..431 CDD:380605 12/32 (38%)
Periplasmic_Binding_Protein_Type_2 446..815 CDD:473866 8/43 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.