DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIB and si:dkey-183j2.10

DIOPT Version :9

Sequence 1:NP_523485.3 Gene:GluRIIB / 33789 FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster
Sequence 2:XP_001923977.1 Gene:si:dkey-183j2.10 / 100151589 ZFINID:ZDB-GENE-130530-729 Length:465 Species:Danio rerio


Alignment Length:434 Identity:138/434 - (31%)
Similarity:225/434 - (51%) Gaps:18/434 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 RFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDLTITQA 515
            :.|||.:||:..||::..|.:....|:|..||..|.| ..|:|:|.:::...|.:.:..||:|.|
Zfish    48 QLEGYCMDLLTELAKKLGFKYKVHLVKDGSYGRQDEN-GNWNGMIGEVVRGEADLAVAPLTLTAA 111

  Fly   516 RRSVVDFTVPFMQLGISILSYKE-PPPKADIYAFLNPYNAEVWLFVMIAMMITAFALIFTGRIDQ 579
            |...|..|.|:||.|||||..|: ...:|..:.||:|::.|.|..::||..:||..:...||:..
Zfish   112 REKAVGMTKPYMQTGISILLRKDIVSEEAGFFDFLSPFSGETWFGILIAYFVTAVCICIVGRLSP 176

  Fly   580 YEWDQPVENVNREMERQNIWHLSNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFALLISQTY 644
            .||.||      |.| .|.:.|.::||...|::..||....|:.:..|:::..||:||:::...|
Zfish   177 CEWSQP------ETE-PNHFTLLHSLWYTAGALSLQGAGPHPKAVSGRVISCTWWLFAVVLLACY 234

  Fly   645 IAKLAAFITSSKIAGDIGSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDA 709
            .:.|::...|......|....||.:|:.:::||:.|.:|..:|..||:...|..:..|...|  :
Zfish   235 FSSLSSTQGSDSAPLMIKGFEDLANQDVIEYGTLAGSSTLAFFKNSNNPSYRRIYEHMERRK--S 297

  Fly   710 FTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLS 774
            |..:.:|||.:.|  :|.|||:.|:.:|...|.|:|||.:..|..|.:.|.|..||.:....|||
Zfish   298 FVSSMDEGVQKAK--EGNYAFIGESVSLDLAVARHCELVRAHEVIGMRGYSIVTPLGSAMLKNLS 360

  Fly   775 VGILRLSERGELFKLRNKWFNSNESTCDSNVPTIDDGQFDMDSVGGLFVVLIVGVVVGLVIGVAE 839
            |.||:|||.|||..||.||:.|  |....|...   ......|:.|:|:||.:|:.:|:::.:.|
Zfish   361 VAILQLSEAGELAYLRTKWWAS--SCLPDNAKA---SSLRAHSMKGIFLVLAIGLGIGVLLSLFE 420

  Fly   840 FLWHVQRISVKEKIPPMLALKAEFYFVIRFWLTRKPLHTYRQSR 883
            .....:..:.::|......|..|....:|...|::...|..:|:
Zfish   421 LTTKSRSAAGEQKKSCCTVLTQELSQRLRMTNTKRDQDTSDKSK 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377
ANF_receptor 41..378 CDD:279440
PBP2_iGluR_Kainate 422..795 CDD:270432 120/344 (35%)
Lig_chan 555..822 CDD:278489 87/266 (33%)
si:dkey-183j2.10XP_001923977.1 PBP2_iGluR_non_NMDA_like 28..381 CDD:270403 120/344 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000021
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.