DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIIA and F59E12.8

DIOPT Version :9

Sequence 1:NP_523484.2 Gene:GluRIIA / 33788 FlyBaseID:FBgn0004620 Length:907 Species:Drosophila melanogaster
Sequence 2:NP_001364714.1 Gene:F59E12.8 / 186629 WormBaseID:WBGene00019123 Length:379 Species:Caenorhabditis elegans


Alignment Length:184 Identity:41/184 - (22%)
Similarity:78/184 - (42%) Gaps:30/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   513 ITQMRRSVVDFTVPFMQLGISILHYKSPPEPKNQFAFL-EPFAVEVWIYMIFAQLIMTLAFVFIA 576
            :|..|.:|:.||.| .|..::.::..:.|:......|| .||:..||:.:....|::.:.| ||.
 Worm    19 MTADRANVLTFTYP-TQFEVNQVYLITDPQKSVDVVFLFHPFSTTVWLLLSLTVLVVAIVF-FIL 81

  Fly   577 RL----SYREWLPPNPAIQDPDELENIWNVNNSTWLMVGSIMQQGCDILPRGPHMRILTGMW--- 634
            |.    |.:|.......||:     :|:.|..||:.:...:.::.....     ..:.:.:|   
 Worm    82 RFVEFKSTKETESSYECIQN-----SIFQVLLSTFNLEIRVAKKSTFFA-----FHLFSTIWLLA 136

  Fly   635 WFFALMMLSTYTANLAAFL-TSNKWQSSIKSLQDLIEQDKVHFGSMRGGSTSLF 687
            ||.  :.:..||:.|:..: .|:|.|....:....|:.       :|.|:..||
 Worm   137 WFH--VFIDFYTSELSGMMVVSDKRQVPFDNFYGFIDH-------LRKGNYRLF 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIIANP_523484.2 PBP1_iGluR_Kainate 33..404 CDD:107377
ANF_receptor 46..386 CDD:279440
PBP2_iGluR_Kainate 426..796 CDD:270432 41/184 (22%)
Lig_chan 556..828 CDD:278489 29/140 (21%)
F59E12.8NP_001364714.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.