DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gng5 and Ggamma30A

DIOPT Version :9

Sequence 1:NP_999886.1 Gene:gng5 / 337838 ZFINID:ZDB-GENE-030131-9966 Length:68 Species:Danio rerio
Sequence 2:NP_001285776.1 Gene:Ggamma30A / 45234 FlyBaseID:FBgn0267252 Length:238 Species:Drosophila melanogaster


Alignment Length:57 Identity:16/57 - (28%)
Similarity:35/57 - (61%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


Zfish     9 AMKKVVQQLRFEANINRVKVSQAAAELQQFCIQNAVHDPLLTGVSSSTNPFRTQKVC 65
            |:||.::.::::|::.|..:|::.||::.|..:|..:|||:.......||:..:..|
  Fly    13 ALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKNDPLINAPDKKNNPWAEKGKC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gng5NP_999886.1 GGL 9..63 CDD:238024 15/53 (28%)
Ggamma30ANP_001285776.1 GGL 11..67 CDD:238024 15/53 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.