DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and H6PD

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001269516.1 Gene:H6PD / 9563 HGNCID:4795 Length:802 Species:Homo sapiens


Alignment Length:268 Identity:63/268 - (23%)
Similarity:102/268 - (38%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SDSVGKWAAKYVMKRINDFQPSADR------YFVLGLPTGSTPLGMYKELIEFHKQGKVSFQYVK 67
            |..|..|:.:.:.|..||.:.:|.|      .|.|.|..||:|:.::::|...|    ..|.:..
Human   564 SPLVSAWSEELISKLANDIEATAVRAVRRFGQFHLALSGGSSPVALFQQLATAH----YGFPWAH 624

  Fly    68 T--FNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAAD-LVAECNKFEDQ----- 124
            |  :.:||......| .||....:..:..:|:.|...|:|.:..:... |.||    |||     
Human   625 THLWLVDERCVPLSD-PESNFQGLQAHLLQHVRIPYYNIHPMPVHLQQRLCAE----EDQGAQIY 684

  Fly   125 IREAGGV------ELFIGGIGPDGHIAFNEP-------GSSLVSRTRVKTLAQDTLEANARFFDN 176
            .||...:      :|.:.|:|.|||.|...|       |..||..|                   
Human   685 AREISALVANSSFDLVLLGMGADGHTASLFPQSPTGLDGEQLVVLT------------------- 730

  Fly   177 DMSKVPKQALTVGVGTVMDSKEVMILITGAHKAFALYKAIEEGVNH---MWTVSAFQQHANTLM- 237
            .....|.:.:::.:..:..:|:|.:|:.|..|  .....:...|.|   .|.:|....|:..|: 
Human   731 TSPSQPHRRMSLSLPLINRAKKVAVLVMGRMK--REITTLVSRVGHEPKKWPISGVLPHSGQLVW 793

  Fly   238 ICDEDATL 245
            ..|.||.|
Human   794 YMDYDAFL 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 63/268 (24%)
H6PDNP_001269516.1 Zwf 33..515 CDD:223441
G6PD_N 40..222 CDD:278882
G6PD_C 236..515 CDD:280876
pgl 567..802 CDD:273494 62/265 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.