DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and SOL3

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_012033.2 Gene:SOL3 / 856568 SGDID:S000001206 Length:249 Species:Saccharomyces cerevisiae


Alignment Length:213 Identity:44/213 - (20%)
Similarity:91/213 - (42%) Gaps:31/213 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 KYVMKRIND-FQPSADRYFVLGLPTGSTPLGMYKELI-EFHKQGKVSFQYVKTFNMDEYVGLARD 80
            ::::|:.:: .|..:|  |.:.:..||....:|:.|: :.....:|.:...:.:..||.:....|
Yeast    19 EFIVKKQDEALQKKSD--FKVSVSGGSLIDALYESLVADESLSSRVQWSKWQIYFSDERIVPLTD 81

  Fly    81 HHESYHYFMWNNFFKHIDIEPKNVHILD----GNAAD----LVAECNKFEDQIREAGGVELFIGG 137
            ...:|..|......|.......||:.:|    |:.|:    :.||..:...|:     ::|.:.|
Yeast    82 ADSNYGAFKRAVLDKLPSTSQPNVYPMDESLIGSDAESNNKIAAEYERIVPQV-----LDLVLLG 141

  Fly   138 IGPDGHIAFNEPGSS---LVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVGTVMDSKEV 199
            .|||||.....||.:   |::.| .|.:|          :.:|..|.|...:|..:..:.|:|.:
Yeast   142 CGPDGHTCSLFPGETHRYLLNET-TKRVA----------WCHDSPKPPSDRITFTLPVLKDAKAL 195

  Fly   200 MILITGAHKAFALYKAIE 217
            ..:..|:.|...:::..:
Yeast   196 CFVAEGSSKQNIMHEIFD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 44/213 (21%)
SOL3NP_012033.2 pgl 6..244 CDD:273494 44/213 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.