DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and Pgls

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_079672.1 Gene:Pgls / 66171 MGIID:1913421 Length:257 Species:Mus musculus


Alignment Length:263 Identity:65/263 - (24%)
Similarity:103/263 - (39%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYKEL-IEFHKQGKVSFQYVKT 68
            :..:...:|...|:.|.:|...........|.|||..||....:.::| ......|..||.....
Mouse    11 VFSSPQELGASLAQLVAQRAASCLEGDRGRFALGLSGGSLVSMLARDLPAAAAPAGPASFARWTL 75

  Fly    69 FNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAADLVAE-CNKFEDQIREA--GG 130
            ...||.: :..||.||.:.....:....:.|....|  |..|.|..|.: ...:..::|:|  |.
Mouse    76 GFCDERL-VPFDHAESTYGLYRTHLLSKLPIPDSQV--LTINPALPVEDAAEDYARKLRQALQGD 137

  Fly   131 V----ELFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGVG 191
            .    :|.|.|:|||||.....|...|: :.|.|.:|.          .:|..|.|.|.:|:.:.
Mouse   138 AVPVFDLLILGVGPDGHTCSLFPDHPLL-QEREKIVAP----------ISDSPKPPPQRVTLTLP 191

  Fly   192 TVMDSKEVMILITGAHKAFALYKAIE--EGVNHMWTVSAFQQHANTLMIC---DEDATLELRVKT 251
            .:..::.::.:.||..||..|.:.:|  ||     |:.|......|..:|   ||.|...|.|..
Mouse   192 VLNAAQSIIFVATGEGKAAVLKRILEDKEG-----TLPAALVQPRTGALCWFLDEAAARLLSVPF 251

  Fly   252 VKY 254
            .|:
Mouse   252 EKH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 64/260 (25%)
PglsNP_079672.1 pgl 11..247 CDD:273494 62/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.