DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and h6pd

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_021332932.1 Gene:h6pd / 569348 ZFINID:ZDB-GENE-110408-60 Length:791 Species:Danio rerio


Alignment Length:269 Identity:61/269 - (22%)
Similarity:109/269 - (40%) Gaps:61/269 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSDSVGKWAAKYVMKRINDFQPSADR------YFVLGLPTGSTPLGMYKELIEFHKQGKVSFQYV 66
            :|:.:..||.:.|.:..:|...:|:.      .|.|.|..||:|:.:.:.|    .....:|.:.
Zfish   552 SSEMISAWAQELVERLASDLLLAAEEAIRREGQFHLALSGGSSPVALLRAL----ALNLYTFPWR 612

  Fly    67 KT--FNMDEYVGLARDHHESYHYF--MWNNFFKHI-----DIEPKNVHIL-------DGNAADLV 115
            .|  :.:||   ....|.||...|  :.:...:||     :|.|..||:.       ||.|    
Zfish   613 NTHIWQVDE---RCVPHTESGSNFRSIHDLLLQHIRIPYFNIHPMPVHLTQRLCVEEDGGA---- 670

  Fly   116 AECNKFEDQIRE---AGGVELFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDT-LEANA-RFFD 175
               ..:|.:|::   |......:.|:|.|||.|               :|.||| ||::. |...
Zfish   671 ---TLYEKEIQKHVNASSFHYILLGVGQDGHTA---------------SLFQDTKLESDGERLVT 717

  Fly   176 NDMSKV-PKQALTVGVGTVMDSKEVMILITG--AHKAFALYKAIEEGVNHMWTVSAFQQHANTLM 237
            ...|.: |.|.:::....:..::.|.:|:.|  .|:.......| :|.:..:.::..|.:..:|:
Zfish   718 LTESPIKPHQRMSLTFTAINKARRVGVLVMGKSKHELVTQLSRI-KGESSRYPITKVQPNNGSLI 781

  Fly   238 -ICDEDATL 245
             ..|.||.|
Zfish   782 WYIDYDALL 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 61/269 (23%)
h6pdXP_021332932.1 G6PD_C 43..508 CDD:332184
6PGL 561..784 CDD:238694 54/252 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.