DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and pgls

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001004117.2 Gene:pgls / 445494 ZFINID:ZDB-GENE-040822-9 Length:254 Species:Danio rerio


Alignment Length:237 Identity:56/237 - (23%)
Similarity:91/237 - (38%) Gaps:48/237 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLVILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYKE------------LIE 54
            |:::..:...:|...|:.:..|......|....|.|||..||....:.||            ||.
Zfish     5 RVLVFSSVGELGSSLAQLLSSRAEKALSSGGSCFSLGLSGGSLVSILSKELPAVPNLDCSKWLIG 69

  Fly    55 FHKQGKVSFQYVKTFNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAADLVAEC- 118
            |..:..|.|.               |...:|..:. |..|..|:|..:.:..:|.:..  |.|| 
Zfish    70 FCDERLVPFS---------------DPESTYGLYK-NQLFGKINIPEERILAIDPSLP--VKECA 116

  Fly   119 NKFEDQIREAGGVE------LFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDTLEANARFFDND 177
            ..:..::.:|...|      :.:.|:|||||.....|...|: :.|.||:|.          .:|
Zfish   117 EDYASKLSKAFSTEKIPVFDVLLLGMGPDGHTCSLFPDHPLL-QERQKTVAP----------ISD 170

  Fly   178 MSKVPKQALTVGVGTVMDSKEVMILITGAHKAFALYKAIEEG 219
            ..|.|.|.:|:.:..|..::.|:.:.||..||..|...:|.|
Zfish   171 SPKPPPQRVTMTLPMVNAARCVVFVSTGGSKAPVLKHVLEGG 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 56/237 (24%)
pglsNP_001004117.2 6PGL 14..233 CDD:238694 55/228 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.