DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and PGLS

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_036220.1 Gene:PGLS / 25796 HGNCID:8903 Length:258 Species:Homo sapiens


Alignment Length:262 Identity:64/262 - (24%)
Similarity:104/262 - (39%) Gaps:28/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILETSDSVGKWAAKYVMKRINDFQPSADRYFVLGLPTGSTPLGMYKEL-IEFHKQGKVSFQYVKT 68
            :..:|..:|...|:.|.:|.......|...|.|||..||....:.:|| ......|..|......
Human    11 VFSSSQELGAALAQLVAQRAACCLAGARARFALGLSGGSLVSMLARELPAAVAPAGPASLARWTL 75

  Fly    69 FNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAADLVAE--CNKFEDQIREA--G 129
            ...||.: :..||.||.:.....:....:.|....|..::   .:|..|  ...:..::|:|  |
Human    76 GFCDERL-VPFDHAESTYGLYRTHLLSRLPIPESQVITIN---PELPVEEAAEDYAKKLRQAFQG 136

  Fly   130 G----VELFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDTLEANARFFDNDMSKVPKQALTVGV 190
            .    .:|.|.|:|||||.....|...|: :.|.|.:|.          .:|..|.|.|.:|:.:
Human   137 DSIPVFDLLILGVGPDGHTCSLFPDHPLL-QEREKIVAP----------ISDSPKPPPQRVTLTL 190

  Fly   191 GTVMDSKEVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHANTL-MICDEDATLELRVKTVKY 254
            ..:..::.|:.:.||..||..|.:.:|:...:....:..|.|...| ...||.|.   |:.||.:
Human   191 PVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAA---RLLTVPF 252

  Fly   255 FK 256
            .|
Human   253 EK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 62/257 (24%)
PGLSNP_036220.1 pgl 11..248 CDD:273494 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.