DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and H6pd

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006538521.1 Gene:H6pd / 100198 MGIID:2140356 Length:826 Species:Mus musculus


Alignment Length:227 Identity:49/227 - (21%)
Similarity:89/227 - (39%) Gaps:55/227 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SDSVGKWAAKYVMKRINDFQPSADR------YFVLGLPTGSTPLGMYKELIEFHKQGKVSFQYVK 67
            |..:..|..:.:.|..:|.:.:|.:      .|.|.|..||:|:.::::|    ..|..||.:..
Mouse   588 SPLITAWPEELISKLASDIEAAAVQAVRHFGKFHLALSGGSSPIALFQQL----ATGHYSFPWAH 648

  Fly    68 T--FNMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHILDGNAAD-LVAECNKFEDQIREA- 128
            |  :.:||......|...::. .:..:..:|:.:...|:|.:..:... |.||    |||..:. 
Mouse   649 THLWLVDERCVPLSDPDSNFQ-GLQAHLLQHVRVPYYNIHPMPVHLHQRLCAE----EDQGAQTY 708

  Fly   129 ----------GGVELFIGGIGPDGHIAFNEP-------GSSLVSRTRVKTLAQDTLEANARFFDN 176
                      ...:|.:.|:|.|||.|...|       |..||..|          |:..|    
Mouse   709 ASEISALVANSSFDLVLLGMGTDGHTASLFPQSPTGLDGDQLVVLT----------ESPFR---- 759

  Fly   177 DMSKVPKQALTVGVGTVMDSKEVMILITGAHK 208
                 |.|.:::.:..:..:|:|.:|:.|..|
Mouse   760 -----PHQRMSLSLPLINRAKKVAVLVMGRTK 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 49/227 (22%)
H6pdXP_006538521.1 PTZ00309 60..539 CDD:240353
pgl 591..826 CDD:273494 48/224 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0363
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.