DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Oscillin and h6pd

DIOPT Version :9

Sequence 1:NP_001245894.1 Gene:Oscillin / 33783 FlyBaseID:FBgn0031717 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_031760646.1 Gene:h6pd / 100127695 XenbaseID:XB-GENE-988586 Length:801 Species:Xenopus tropicalis


Alignment Length:284 Identity:56/284 - (19%)
Similarity:99/284 - (34%) Gaps:97/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VGKWAAKYVMKRINDFQPSADR------YFVLGLPTGSTPLGMYKELIEFHKQGKVSFQYVKTF- 69
            |..||.:.:.|...|.|.:|:.      .|.|.|..|||||.:::.|.:.|.    .|.:.:|. 
 Frog   566 VSNWAEQLIEKLARDIQLAAESAVQHSGVFHLALSGGSTPLALFQRLSKHHH----GFPWKRTHL 626

  Fly    70 ------------------NMDEYVGLARDHHESYHYFMWNNFFKHIDIEPKNVHIL--DGN---- 110
                              |:::|:                  .:|:.:...|:|.:  |.|    
 Frog   627 WLVDERCVPFTEPDSNFGNIEKYL------------------LQHVRVPYINIHPMPVDRNQRIC 673

  Fly   111 -AADLVAE--CNKFEDQIREAGGVELFIGGIGPDGHIAFNEPGSSLVSRTRVKTLAQDTLEANAR 172
             ..||..|  ..:....:..: ..::.:.|:|.|||.|...||            |||.:|.:..
 Frog   674 SEEDLGTEVYAKEISSHVSNS-SFDMVLLGLGNDGHTASIFPG------------AQDGIEGHKF 725

  Fly   173 FFDNDMSKVPKQALTVGVGTVMDSKEVMILI--TGAHKAFALYKAIEE--------GVNH----- 222
            ....:....|.:.:::.:..:..::|:.:|:  .|.|....|....|.        |||.     
 Frog   726 VLFTESPGKPHRRMSLSLSLINKAREIAVLVLGKGKHDIITLISRAERSPIKWPIFGVNPTFGKL 790

  Fly   223 MWTVSAFQQHANTLMICDEDATLE 246
            :|.:             |.||.|:
 Frog   791 VWYI-------------DYDALLK 801

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OscillinNP_001245894.1 SugarP_isomerase 1..253 CDD:294243 56/284 (20%)
h6pdXP_031760646.1 PTZ00309 38..518 CDD:240353
Glucosamine_iso 570..792 CDD:395940 49/256 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.