DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and INA

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_116116.1 Gene:INA / 9118 HGNCID:6057 Length:499 Species:Homo sapiens


Alignment Length:481 Identity:140/481 - (29%)
Similarity:222/481 - (46%) Gaps:97/481 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PPSTHSQTASSPLSPTRHSRVA---EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTV 93
            ||::.....|...:.|...::.   ||.:||.||||.|.:|::|..|||:|..|..|:...|.. 
Human    69 PPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQR- 132

  Fly    94 TRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVR 158
            ..|.:.:..:|:.||.:.|..|::.:..|::|.::...|.||.:.|:.:.::             
Human   133 HAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEE------------- 184

  Fly   159 MYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSL 223
              |||..|        .|:|         |||..:|          :::..||:|:|||..::||
Human   185 --ESRGRE--------GAER---------ALKAQQR----------DVDGATLARLDLEKKVESL 220

  Fly   224 REELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYD---AK--LKQSLQELRAQYEEQMQINR 283
            .:||:|..|:|.:|:.|.....|.     ..:.::|.|   ||  |..:|:|:|||||.....|.
Human   221 LDELAFVRQVHDEEVAELLATLQA-----SSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNL 280

  Fly   284 DEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLER 348
            ...:..|:.|...|.|.|||::.:...|.||:...|.::.|....|..|..||..|..:|.:|| 
Human   281 QSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELE- 344

  Fly   349 QLDNDRERHGQE-------IDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGE 406
                  |||..|       |..||.:|...:.||.:.|:|||||:::|::||:|||||.|||.||
Human   345 ------ERHSAEVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGE 403

  Fly   407 EAR----------LNITP-----------ATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRA 450
            |.|          ||..|           :..|:.|.|...||:.......:.:..|    :|.:
Human   404 ETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVAS----KKTS 464

  Fly   451 VVDESEDHSVADYYVSA--SAKGNVE 474
            .:.||.:..:.:..:|.  :.|.|:|
Human   465 QIGESFEEILEETVISTKKTEKSNIE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 119/366 (33%)
Ax_dynein_light <283..377 CDD:287215 30/100 (30%)
LTD 466..572 CDD:279300 4/11 (36%)
INANP_116116.1 Head 1..87 4/17 (24%)
Filament_head 10..92 CDD:282575 4/22 (18%)
Coil 1A 88..129 17/40 (43%)
Filament 93..406 CDD:278467 119/367 (32%)
Linker 1 130..142 2/12 (17%)
Coil 1B 143..238 35/136 (26%)
Linker 2 239..262 5/27 (19%)
Coil 2 263..408 59/151 (39%)
Tail 409..499 16/86 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..466 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.