DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and Nefl

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_113971.1 Gene:Nefl / 83613 RGDID:621458 Length:542 Species:Rattus norvegicus


Alignment Length:517 Identity:138/517 - (26%)
Similarity:238/517 - (46%) Gaps:85/517 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTH----SQTASSPLSPTRHSRVAEKVELQNLN 62
            :::|..:..:.|...:.|..|..|:......||..    ||.|:.. :..:..|..||.:||:||
  Rat    35 TARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAIS-NDLKSIRTQEKAQLQDLN 98

  Fly    63 DRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEI 127
            ||.|::|:||..||.:|                      .:.|||||..|:...:.:|.||..|.
  Rat    99 DRFASFIERVHELEQQN----------------------KVLEAELLVLRQKHSEPSRFRALYEQ 141

  Fly   128 DIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKEL 192
            :|:       :|:...:..|.|....:|.....|.....|..:|.:....|:.....|.||    
  Rat   142 EIR-------DLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEA---- 195

  Fly   193 ERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLS 257
                      ||..::..|:|.:||..|.||.:|::|..::|.:||.|.:  .|.:|::|...:.
  Rat   196 ----------RKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQ--AQIQYAQISVEMD 248

  Fly   258 SEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRI 322
            ......|..:|:::|||||:....|....:..::.:...|.|:||:.:::...:.:|:..:|..:
  Rat   249 VSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESRRLL 313

  Fly   323 DALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMD 387
            .|....|......|..|..::::||.:.:.|.......|:.||.||...:.||.:.|||||||::
  Rat   314 KAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRSTKSEMARYLKEYQDLLN 378

  Fly   388 IKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQS-----------LRNSTRATPSRRTP 441
            :|::||:|||||.|||.|||.||:.|...:..:  .:|||           |::|:....:|..|
  Rat   379 VKMALDIEIAAYRKLLEGEETRLSFTSVGSITS--GYSQSSQVFGRSAYSGLQSSSYLMSARAFP 441

  Fly   442 ---SAAVKRKRAVVDESEDHSVADYYVSASAK------GNVEIKEIDPEGKFVRLFNKGSEE 494
               ::.|:.:::.|:|:.:.:.|:     .||      |..|.:|.:.|        :|.||
  Rat   442 AYYTSHVQEEQSEVEETIEATKAE-----EAKDEPPSEGEAEEEEKEKE--------EGEEE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 104/354 (29%)
Ax_dynein_light <283..377 CDD:287215 20/93 (22%)
LTD 466..572 CDD:279300 9/35 (26%)
NeflNP_113971.1 Head 2..93 13/58 (22%)
Filament_head 9..88 CDD:282575 10/53 (19%)
Filament 89..400 CDD:278467 104/355 (29%)
Coil 1A 94..125 18/52 (35%)
Linker 1 126..138 3/11 (27%)
Coil 1B 139..234 27/115 (23%)
GBP_C <140..239 CDD:303769 29/121 (24%)
coiled coil 212..222 CDD:293879 4/9 (44%)
Linker 12 235..253 3/19 (16%)
Coil 2A 254..272 7/17 (41%)
Linker 2 273..281 1/7 (14%)
Coil 2B 282..397 38/114 (33%)
Epitope, recognized by IF-specific monoclonal antibody 382..392 7/9 (78%)
Tail 398..542 24/108 (22%)
Tail, subdomain A 398..444 11/47 (23%)
Tail, subdomain B (acidic) 445..542 13/59 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..542 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.