DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and krt5

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_571231.2 Gene:krt5 / 797351 ZFINID:ZDB-GENE-991110-23 Length:566 Species:Danio rerio


Alignment Length:424 Identity:126/424 - (29%)
Similarity:210/424 - (49%) Gaps:85/424 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GPQPPPPSTHSQTASSPLS----PT-RHSRVAEKVELQNLNDRLATYIDRVRNLETENSRL---- 82
            |..|....|.:|...:||:    |. :..|..||.:::.||:|.|::||:||.||.:|..|    
Zfish   125 GVVPITAVTVNQNLLAPLNLEIDPNIQVVRTQEKEQIKTLNNRFASFIDKVRFLEQQNKVLETKW 189

  Fly    83 -TIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKK 146
             .::.|||    ||  :||..:|||.:...||.||....::.:.|.::|.:....|:.|||    
Zfish   190 SLLQEQTT----TR--SNIDAMFEAYIANLRRQLDGLGNEKMKLEGELKNMQNLVEDFKNK---- 244

  Fly   147 TKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETL 211
                         ||   :|:|.:                      ..:..:|...:|:::...:
Zfish   245 -------------YE---DEINKR----------------------AAVENEFVLLKKDVDAAYM 271

  Fly   212 SRVDLENTIQSLREELSFKDQIHSQEINE-SRRIKQTE-YSEIDGRLSSEYDAKLKQSLQELRAQ 274
            ::|:||..:.||::|::|...|..:|:.| ..:||.|. ..|:|...:.:.||    .:.|:|||
Zfish   272 NKVELEAKVDSLQDEINFLRAIFEEELRELQSQIKDTSVVVEMDNSRNLDMDA----IVAEVRAQ 332

  Fly   275 YEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADL 339
            ||:....:|.|.:|.|:.|.:.:|.:|.:..       ::||:|:..|..||..|:.|:.....:
Zfish   333 YEDIANRSRAEAESWYKQKFEEMQSSAGKYG-------DDLRNTKAEIADLNRMISRLQNEIEAV 390

  Fly   340 NARIRDLERQLDNDRERHGQ--------EIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEI 396
            ..:..:||.|:....|| |:        .|..||..|.|.:::|.:|::|||:||::|::||:||
Zfish   391 KGQRANLEAQIAEAEER-GELAVKDAKLRIKDLEDALQRAKQDMARQVREYQELMNVKLALDIEI 454

  Fly   397 AAYDKLLVGEEARLNITPATNTATV---QSFSQS 427
            |.|.|||.|||:|  |....||||:   :|.|.|
Zfish   455 ATYRKLLEGEESR--IASGGNTATIHIQESSSSS 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 109/369 (30%)
Ax_dynein_light <283..377 CDD:287215 27/101 (27%)
LTD 466..572 CDD:279300
krt5NP_571231.2 Keratin_2_head <129..153 CDD:292825 5/23 (22%)
Filament 156..467 CDD:278467 109/370 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.