DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and krt4

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_571584.2 Gene:krt4 / 794486 ZFINID:ZDB-GENE-000607-83 Length:497 Species:Danio rerio


Alignment Length:411 Identity:123/411 - (29%)
Similarity:208/411 - (50%) Gaps:80/411 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 THSQTASSPLS----PTRHS-RVAEKVELQNLNDRLATYIDRVRNLETENSRL-----TIEVQTT 89
            |.:|:..:||:    ||..: |..||.:::.||:|.|::||:||.||.:|..|     .::.|||
Zfish    90 TVNQSLLAPLNLEIDPTIQAVRTQEKEQIKTLNNRFASFIDKVRFLEQQNKMLETKWSLLQEQTT 154

  Fly    90 RDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAE 154
                ||  :||..:|||.:...||.||....::.:.|.::|.:....|:.|||            
Zfish   155 ----TR--SNIDAMFEAYISNLRRQLDGLGNEKMKLEGELKNMQGLVEDFKNK------------ 201

  Fly   155 GNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENT 219
                 ||   :|:|.:.:..|                      :|...:|:::...:::|:||..
Zfish   202 -----YE---DEINKRASVEN----------------------EFVLLKKDVDAAYMNKVELEAK 236

  Fly   220 IQSLREELSFKDQIHSQEINE-SRRIKQTE-YSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQIN 282
            :.:|::|::|...::..|:.| ..:||.|. ..|:|...:.:.|:    .:.|:|||||:....:
Zfish   237 VDALQDEINFLRAVYEAELRELQSQIKDTSVVVEMDNSRNLDMDS----IVAEVRAQYEDIANRS 297

  Fly   283 RDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLE 347
            |.|.:|.|:.|.:.:|..|.:..       ::||||:..|..||..|..|:.....:.|:..:||
Zfish   298 RAEAESWYKQKFEEMQSTAGQYG-------DDLRSTKAEIAELNRMIARLQNEIDAVKAQRANLE 355

  Fly   348 RQLDNDRERHGQ--------EIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLV 404
            .|:....|| |:        .|..||:.|.|.:::|.:|::|||:||::|::||:|||.|.|||.
Zfish   356 AQIAEAEER-GELAVKDAKLRIRELEEALQRAKQDMARQVREYQELMNVKLALDIEIATYRKLLE 419

  Fly   405 GEEARLNITPATNTATVQSFS 425
            |||:||:...|..|..||..|
Zfish   420 GEESRLSSGGAQATIHVQQTS 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 109/369 (30%)
Ax_dynein_light <283..377 CDD:287215 29/101 (29%)
LTD 466..572 CDD:279300
krt4NP_571584.2 Keratin_2_head <82..110 CDD:292825 6/19 (32%)
Filament 113..424 CDD:278467 109/370 (29%)
DUF2570 304..399 CDD:305162 29/102 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.