DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and VIM

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_003371.2 Gene:VIM / 7431 HGNCID:12692 Length:466 Species:Homo sapiens


Alignment Length:506 Identity:141/506 - (27%)
Similarity:239/506 - (47%) Gaps:101/506 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSKSRR----AGTATPQPGN-----TSTPRPPSAGPQPPPPSTHSQTASSP--LSPTRHS----- 50
            ||..||    .|||: :|.:     |::.|..|.|....|.::.|..||||  :..||.|     
Human     8 SSSYRRMFGGPGTAS-RPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLR 71

  Fly    51 ----------------------------RVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQ 87
                                        |..||||||.||||.|.|||:||.||.:|..|..|::
Human    72 SSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELE 136

  Fly    88 TTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTT 152
            ..:.   :..:.:.:::|.|:.|.||.:|....|:||.|::...|.|                  
Human   137 QLKG---QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAE------------------ 180

  Fly   153 AEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLE 217
                                    |..:|.|.|.|.:.:.|......:..|::::..:|:|:|||
Human   181 ------------------------DIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLE 221

  Fly   218 NTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQIN 282
            ..::||:||::|..::|.:||.|.:...|.::.:||..:|.   ..|..:|:::|.|||.....|
Human   222 RKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSK---PDLTAALRDVRQQYESVAAKN 283

  Fly   283 RDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLE 347
            ..|.:..|:.|...|.|||.|.:::..::.:|....|.::.:|...::.|:..|..|..::|::|
Human   284 LQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREME 348

  Fly   348 RQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNI 412
            .....:...:...|..|:.|:..::|||.:.|:|||||:::|::||:|||.|.|||.|||:|:::
Human   349 ENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISL 413

  Fly   413 TPATNTATVQSFSQSLRNSTRA-TPSRRTPSAAVK----RKRAVVDESEDH 458
             |..|.:::.....:|.:.... |.|:||  ..:|    |...|::|:..|
Human   414 -PLPNFSSLNLRETNLDSLPLVDTHSKRT--LLIKTVETRDGQVINETSQH 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 106/354 (30%)
Ax_dynein_light <283..377 CDD:287215 22/93 (24%)
LTD 466..572 CDD:279300
VIMNP_003371.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 8/24 (33%)
Head 2..95 21/87 (24%)
Filament_head 14..101 CDD:368088 17/87 (20%)
Coil 1A 96..131 20/34 (59%)
Filament 102..410 CDD:365827 106/355 (30%)
Linker 1 132..153 2/23 (9%)
Coil 1B 154..245 30/132 (23%)
Linker 12 246..268 5/24 (21%)
Coil 2 269..407 44/137 (32%)
[IL]-x-C-x-x-[DE] motif. /evidence=ECO:0000305|PubMed:25417112 326..329 1/2 (50%)
Tail 408..466 14/57 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.