DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and zgc:172323

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001107899.1 Gene:zgc:172323 / 564165 ZFINID:ZDB-GENE-080204-113 Length:847 Species:Danio rerio


Alignment Length:468 Identity:118/468 - (25%)
Similarity:207/468 - (44%) Gaps:105/468 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKSRRAGTATPQPGNTSTPRPP-----------SAGPQPPPPSTHSQTASSPLSPTRHSRVAEKV 56
            |.||..|..|.   :||..:|.           |.|    .|......|::.......:|.:||.
Zfish    54 SNSRAVGRRTI---STSRSQPHLNGVGMGAICLSGG----GPGADLDQAAAENREFLSTRTSEKQ 111

  Fly    57 ELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDD---- 117
            |:..||||||.||::||:||.:|..|..|::..::...: .|.::.::|.:|.|..||.|.    
Zfish   112 EMILLNDRLAAYIEKVRSLEQQNKLLETEIEVLQNRFLK-PTGLRLLYEEQLKELMRLADQMRVQ 175

  Fly   118 -----TARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANAD 177
                 .|:|....:::|.::                                     ||.:|...
Zfish   176 RDIAIAAKDAMAGQLEIIKV-------------------------------------KYEEALEM 203

  Fly   178 RKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESR 242
            |||...|:              |..|.:::..|.:|:.||..:::|..||.|..::|.|||.|..
Zfish   204 RKKAELDI--------------EAFRPDVDAATSARIALEKQLENLEVELEFLRRVHKQEIEELM 254

  Fly   243 RIKQTEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAAR 303
            :       :|....:|..||    .|..:|::::.||::....|..|:.|.|::|...|      
Zfish   255 K-------QIYAAHASAMDAYSLPDLSNALKQIQHQYDDIAAKNLQEMDSWYKNKFDDL------ 306

  Fly   304 TSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQE-------I 361
             :|.|.|.::::|..|..|.:...:|...|:....:|.:...||.|:.:.::::.:|       |
Zfish   307 -NNKTSKHVDQVRHVREGIASAKKDIQNKERDMDSMNTKNEALEAQIRDTQDKYRKELEDLQARI 370

  Fly   362 DLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARL-NITPATNTATVQSFS 425
            :.|:.||...::.....|:|||||:::|:||::||..|.||:.||::|| ::..:..|.|:.|.|
Zfish   371 EALQLELKSSKQRTALLLREYQDLLNVKMSLEIEITTYRKLIEGEDSRLTSMVQSMQTMTLMSGS 435

  Fly   426 QSLRNSTRATPSR 438
            .|:........:|
Zfish   436 TSVHTVAAGAANR 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 97/374 (26%)
Ax_dynein_light <283..377 CDD:287215 22/100 (22%)
LTD 466..572 CDD:279300
zgc:172323NP_001107899.1 Filament_head 7..107 CDD:282575 12/59 (20%)
Filament 108..418 CDD:278467 97/375 (26%)
DUF4200 123..248 CDD:290574 37/176 (21%)
BBP1_C 229..378 CDD:291921 40/162 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.