DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and KRT76

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_056932.2 Gene:KRT76 / 51350 HGNCID:24430 Length:638 Species:Homo sapiens


Alignment Length:394 Identity:95/394 - (24%)
Similarity:190/394 - (48%) Gaps:65/394 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETT-----NIKNIFEAELLE 110
            :..|:.:::.||::.|::||:||.||.:|..|    :|..:.:.::||     :::..||:.:..
Human   180 KAQEREQIKTLNNKFASFIDKVRFLEQQNKVL----ETKWELLQQQTTGSGPSSLEPCFESYISF 240

  Fly   111 TRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQAN 175
            ..:.||....:|...|.::|.:.:..|:.|.|.:.:..:.|.||                     
Human   241 LCKQLDSLLGERGNLEGELKSMQDLVEDFKKKYEDEINKRTAAE--------------------- 284

  Fly   176 ADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINE 240
                                 .:|...:|:::...:::|:|:..:.||.:|:||...::..|:::
Human   285 ---------------------NEFVGLKKDVDAAFMNKVELQAKVDSLTDEVSFLRTLYEMELSQ 328

  Fly   241 SRRIKQTEYSEIDGRLSSEYD--AKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAAR 303
                .|:..|:....||.:.:  ..|...:.|:||||||..|.::.|.::||:.|:..||..|.|
Human   329 ----MQSHASDTSVVLSMDNNRCLDLGSIIAEVRAQYEEIAQRSKSEAEALYQTKLGELQTTAGR 389

  Fly   304 TSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKEL 368
            ..:....:..|:......|..|.|.|..:::.||:|...|.:.|::.:...:....::..|:..|
Human   390 HGDDLRNTKSEIMELNRMIQRLRAEIENVKKQNANLQTAIAEAEQRGEMALKDANAKLQDLQTAL 454

  Fly   369 IRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLN--------ITPATNTATVQSFS 425
            .:.::::.:.|::||:||::|::||:|||.|.|||.|||.|::        |:..:|..:....|
Human   455 QKAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEECRMSGECQSAVCISVVSNVTSTSGSS 519

  Fly   426 QSLR 429
            .|.|
Human   520 GSSR 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 89/361 (25%)
Ax_dynein_light <283..377 CDD:287215 20/93 (22%)
LTD 466..572 CDD:279300
KRT76NP_056932.2 Head 1..182 0/1 (0%)
Keratin_2_head 16..179 CDD:292825
Filament 182..495 CDD:278467 89/362 (25%)
Coil 1A 183..218 13/38 (34%)
Linker 1 219..237 4/17 (24%)
Coil 1B 238..329 21/136 (15%)
Linker 12 330..353 5/22 (23%)
Coil 2 354..492 43/137 (31%)
RILP-like <408..469 CDD:304877 12/60 (20%)
Tail 493..638 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 532..638
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.