DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and NEFL

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_006149.2 Gene:NEFL / 4747 HGNCID:7739 Length:543 Species:Homo sapiens


Alignment Length:509 Identity:142/509 - (27%)
Similarity:234/509 - (45%) Gaps:88/509 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTH----SQTASSPLSPTRHSRVAEKVELQNLN 62
            :::|..:..:.|...:.|..|..|:......||..    ||.|:.. :..:..|..||.:||:||
Human    35 TARSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENLDLSQVAAIS-NDLKSIRTQEKAQLQDLN 98

  Fly    63 DRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEI 127
            ||.|::|:||..||.:|                      .:.|||||..|:...:.:|.||..|.
Human    99 DRFASFIERVHELEQQN----------------------KVLEAELLVLRQKHSEPSRFRALYEQ 141

  Fly   128 DIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKEL 192
            :|:       :|:...:..|.|....:|.....|.....|..:|.:....|:.....|.||    
Human   142 EIR-------DLRLAAEDATNEKQALQGEREGLEETLRNLQARYEEEVLSREDAEGRLMEA---- 195

  Fly   193 ERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLS 257
                      ||..::..|:|.:||..|.||.:|:||..::|.:||.|.:  .|.:|::|    |
Human   196 ----------RKGADEAALARAELEKRIDSLMDEISFLKKVHEEEIAELQ--AQIQYAQI----S 244

  Fly   258 SEYDA---KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTR 319
            .|.|.   .|..:|:::|||||:....|....:..::.:...|.|:||:.:::...:.:|:..:|
Human   245 VEMDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVRAAKDEVSESR 309

  Fly   320 VRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQD 384
            ..:.|....|......|..|..::::||.:.:.|.......|:.||.||...:.||.:.||||||
Human   310 RLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELRTTKSEMARYLKEYQD 374

  Fly   385 LMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLR----------------NSTR 433
            |:::|::||:|||||.|||.|||.||:.|...:..:  .:|||.:                .|||
Human   375 LLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITS--GYSQSSQVFGRSAYGGLQTSSYLMSTR 437

  Fly   434 ATPSRRTPSAAVKRKRAVVDESEDHSVADYYVSASAK------GNVEIKEIDPE 481
            :.||..|  :.|:.::..|:|:.:.:.|:     .||      |..|.:|.|.|
Human   438 SFPSYYT--SHVQEEQIEVEETIEAAKAE-----EAKDEPPSEGEAEEEEKDKE 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 108/357 (30%)
Ax_dynein_light <283..377 CDD:287215 20/93 (22%)
LTD 466..572 CDD:279300 7/22 (32%)
NEFLNP_006149.2 Head 2..92 12/57 (21%)
Filament_head 9..88 CDD:309741 10/53 (19%)
Filament 89..399 CDD:306535 108/358 (30%)
Coil 1A 93..124 17/52 (33%)
Linker 1 125..137 2/11 (18%)
Coil 1B 138..234 28/116 (24%)
Linker 12 235..252 6/22 (27%)
Coil 2A 253..271 7/17 (41%)
Linker 2 272..280 1/7 (14%)
Coil 2B 281..396 38/114 (33%)
Epitope, recognized by IF-specific monoclonal antibody 381..391 7/9 (78%)
Tail 397..543 24/97 (25%)
Tail, subdomain A 397..443 12/47 (26%)
Tail, subdomain B (acidic) 444..543 12/48 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..543 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.