DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and NEFH

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_066554.2 Gene:NEFH / 4744 HGNCID:7737 Length:1020 Species:Homo sapiens


Alignment Length:514 Identity:133/514 - (25%)
Similarity:214/514 - (41%) Gaps:96/514 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKSRRAGTATPQPGNTSTPRPPSAGPQPPPPSTHSQTASSPLSPTRHSRVAEKVELQNLNDRLAT 67
            |:.|.||.|:    :|.:....|.||:            ..:.....|| :||.:||.||||.|.
Human    63 SRFRGAGAAS----STDSLDTLSNGPE------------GCMVAVATSR-SEKEQLQALNDRFAG 110

  Fly    68 YIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRL 132
            |||:||.||..|..|..|....|......:. :..::|.|:.|.|..:......|.:..::.:.|
Human   111 YIDKVRQLEAHNRSLEGEAAALRQQQAGRSA-MGELYEREVREMRGAVLRLGAARGQLRLEQEHL 174

  Fly   133 WEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRK 197
            .|:...::.:||                                |..:..|:...|.:.|.|..:
Human   175 LEDIAHVRQRLD--------------------------------DEARQREEAEAAARALARFAQ 207

  Fly   198 QFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDG------RL 256
            :.|          .:||||:...|:|:||..:..:.|.:|:.|.       ..:|.|      ::
Human   208 EAE----------AARVDLQKKAQALQEECGYLRRHHQEEVGEL-------LGQIQGSGAAQAQM 255

  Fly   257 SSEYDAKLK----QSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRS 317
            .:|....||    .:|:|:|||.|.....:..:.:..:..::.||.|||...:::...:.||:..
Human   256 QAETRDALKCDVTSALREIRAQLEGHAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITE 320

  Fly   318 TRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEY 382
            .|.::.|....:..|:.....|..:..:||.:...|...:.:.|..|:.||...:.||..||:||
Human   321 YRRQLQARTTELEALKSTKDSLERQRSELEDRHQADIASYQEAIQQLDAELRNTKWEMAAQLREY 385

  Fly   383 QDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTP-SAAVK 446
            |||:::|::||:|||||.|||.|||.|:...|         ...||.......||..|. ....:
Human   386 QDLLNVKMALDIEIAAYRKLLEGEECRIGFGP---------IPFSLPEGLPKIPSVSTHIKVKSE 441

  Fly   447 RKRAVVDESEDHSV------ADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGG 499
            .|..||::||..:|      .:..|:.......|.:..:.|||..   ..|.||.|.||
Human   442 EKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKEEEGKEE---EGGEEEEAEGG 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 98/364 (27%)
Ax_dynein_light <283..377 CDD:287215 20/93 (22%)
LTD 466..572 CDD:279300 10/34 (29%)
NEFHNP_066554.2 Head 1..100 13/53 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..83 7/23 (30%)
Filament 96..412 CDD:278467 98/365 (27%)
Coil 1A 101..132 17/30 (57%)
Linker 1 133..145 1/12 (8%)
Coil 1B 146..244 26/146 (18%)
Linker 12 245..266 5/20 (25%)
Coil 2A 267..288 6/20 (30%)
Linker 2 289..292 0/2 (0%)
Coil 2B 293..413 41/119 (34%)
BASP1 513..736 CDD:283191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.