DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and krt78.7

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001006716.1 Gene:krt78.7 / 448361 XenbaseID:XB-GENE-876590 Length:631 Species:Xenopus tropicalis


Alignment Length:411 Identity:108/411 - (26%)
Similarity:193/411 - (46%) Gaps:70/411 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PQPPPPSTHSQTASS----PLSPT-----RHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLT 83
            |..||......|.::    ||:.|     :..:..|:.:::.||::.|.|||:||.||.:|..|.
 Frog   157 PVCPPGGIQQVTINTQLLQPLNLTIDPNVQKVKTEEREQIKTLNNKFAAYIDKVRFLEQQNKVLE 221

  Fly    84 IEVQTTRDTVTRETT---NIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDK 145
            .:.:..::..|:.:|   :::.:||..:.:.||.||....::||...::|.|.:..||.|.|   
 Frog   222 TKWKLLQEQGTKGSTKRASLEPLFEKYIGDLRRYLDTLTNEKARLLQELKNLQDLVEEYKKK--- 283

  Fly   146 KTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQET 210
                          ||...|:           |.|...|              |...:|:::...
 Frog   284 --------------YEDEINK-----------RTKAEND--------------FVVLKKDVDAAY 309

  Fly   211 LSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDG----RLSSEYDAKLKQSLQEL 271
            :.:.:||..:.::..|::|...:.:.|::      |...|..|.    .:.:..|..|:..:|::
 Frog   310 MIKTELEAKVDAVTSEINFLRTLFAAELS------QVHDSVTDTSVVLTMDNNRDFNLEGIIQDV 368

  Fly   272 RAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTRVRIDALNANINELEQAN 336
            :||.|...|.::.|.::||::|.:.||..|....:|...|..|:.....||..|.|.|..:::..
 Frog   369 KAQLELAAQRSKMEAEALYDNKYKELQRTAEGHGDSIKNSKTEIAELNRRIQRLRAEIENIKKQI 433

  Fly   337 ADLNARIRDLERQLD---NDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAA 398
            |.||..|...|.:.:   .|.|:..|:::..||   :|:|:|.:||||||:|:..|:|||:||:.
 Frog   434 AGLNQSIAGAEEKGNLALKDAEKKLQDLEAAEK---KLKEDMARQLKEYQELLAAKISLDVEIST 495

  Fly   399 YDKLLVGEEARLNITPATNTA 419
            |..:|.|||.|::...|.|.:
 Frog   496 YGLMLGGEEGRMSGEIANNVS 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 98/364 (27%)
Ax_dynein_light <283..377 CDD:287215 28/96 (29%)
LTD 466..572 CDD:279300
krt78.7NP_001006716.1 Keratin_2_head <156..188 CDD:374433 7/30 (23%)
Filament 191..506 CDD:365827 98/365 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D204815at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.