DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and krt91

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_001003445.1 Gene:krt91 / 445051 ZFINID:ZDB-GENE-040801-181 Length:466 Species:Danio rerio


Alignment Length:418 Identity:106/418 - (25%)
Similarity:197/418 - (47%) Gaps:76/418 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDT 118
            :|..:||||||||:|:::||:||..|:.|.:::                         |:.||..
Zfish   103 DKATMQNLNDRLASYLEKVRSLEKANADLELKI-------------------------RQFLDSK 142

  Fly   119 ARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNE 183
            ....||   |....:....:|:||:    ::.|...|.:.:      .::|....|:..|.|...
Zfish   143 TSPSAR---DYSAYYATISDLQNKI----QDATRINGGIYL------SIDNAKLAADDFRVKYEN 194

  Fly   184 DLNEALKELERLRKQFEE----TRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRI 244
            :|:        :|:..|.    .||.|::.|::|.|||..|:.|:|||.|..:.|.:|:..:|  
Zfish   195 ELS--------MRQSVEADIAGLRKVLDELTMTRSDLEMQIEGLKEELIFLKKNHEEELLAAR-- 249

  Fly   245 KQTEYSEIDGRLSSEYDA----KLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQE---AAA 302
                 .::.|::..|.||    .|.:.:.::|..||:....|:.:::..::.|.:.|.:   |:.
Zfish   250 -----GQMSGQVHVEVDAAPQEDLTKVMADIREHYEQVAAKNQRDLEHWFQSKSESLNKEVAAST 309

  Fly   303 RTSNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKE 367
            .|..||...|.||:.|   :..|...:.......|.|...:.|.:.:..|....:..::..:|::
Zfish   310 ETLQSTKSEITELKRT---LQGLEIELQSQLSMKASLEGTLADTQARYGNMLNGYQMQVGNMEEQ 371

  Fly   368 LIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNST 432
            |::||.::.:|.:|||.|:|||..|::|||.|.:||.||.:|.:.|.:|...:         :::
Zfish   372 LMQLRADLERQGQEYQMLLDIKTRLEMEIAEYRRLLDGEASRSSQTVSTTKTS---------STS 427

  Fly   433 RATPSRRTPSAAVKRKRAVVDESEDHSV 460
            .:.||..:.|...::...:|:|.:|..|
Zfish   428 SSAPSSTSTSTTTRKVVTIVEEVKDGKV 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 96/365 (26%)
Ax_dynein_light <283..377 CDD:287215 19/96 (20%)
LTD 466..572 CDD:279300
krt91NP_001003445.1 Filament 102..413 CDD:278467 96/365 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.