DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and viml

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_957067.1 Gene:viml / 393746 ZFINID:ZDB-GENE-040426-1743 Length:447 Species:Danio rerio


Alignment Length:489 Identity:133/489 - (27%)
Similarity:232/489 - (47%) Gaps:94/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRRAGTATPQPGNTSTPRPPSAGPQPPP----------------PSTHSQTASSPLSPT-----R 48
            ||.:..::.|..::|.....|.|....|                |...|:|....||..     :
Zfish    14 SRSSALSSRQTFSSSARTRVSFGASSSPVIYASKSAKVRSSAAMPRLTSETLDFNLSDALNTEFK 78

  Fly    49 HSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRR 113
            .:|:.||.::|:||||.|:||::||.||.:|..|:.|::..|.   :.::.|.:::|.|:.:.||
Zfish    79 ANRLNEKAQMQSLNDRFASYIEKVRFLEQQNKILSAELEQLRG---QRSSRIADLYEEEMRDLRR 140

  Fly   114 LLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADR 178
            .:|....::.|||:....|.|:.|.||.||.                                |.
Zfish   141 QVDLLTTEKTRAEVMRDNLAEDVERLKEKLQ--------------------------------DE 173

  Fly   179 KKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRR 243
            ....||...::|..          |::::...|:|||||..::||::||:|...:|.:|:.|.: 
Zfish   174 MLQREDAENSMKSF----------RQDVDNAALARVDLERKVESLQDELAFLKNLHDEELAELQ- 227

  Fly   244 IKQTEYSEIDG-RLSSEYD-AK--LKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAART 304
                  ::|.| ::..|.| ||  |..:|:::|.|||.....|..|.:..|:.|...|.|||.|.
Zfish   228 ------TQIQGQQVQVEMDMAKPDLTAALRDVRLQYENLASKNIQESEDWYKSKFADLTEAANRN 286

  Fly   305 SNSTHKSIEELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELI 369
            :.:...:.:|....|.::.|:...::.|...|..|..::|::|.....:.......|..||:::.
Zfish   287 NEALRLAKQETNEYRRQVQAITCELDALRGTNESLERQMREMEENFGMESSGFQDTIGRLEEDIG 351

  Fly   370 RLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQ-SLRNS-- 431
            .:::||.:.|:|||||:::|::||:|||.|.|||.|||:|:       .|.:.:||. :||.:  
Zfish   352 NMKDEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRI-------AAPLPNFSSFNLRETML 409

  Fly   432 -TRATPSRR-TPSAAVK----RKRAVVDES-EDH 458
             ::..|... |....:|    |...|::|| ::|
Zfish   410 ESKLVPENTFTKKVLIKTIETRDGQVINESTQNH 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 106/358 (30%)
Ax_dynein_light <283..377 CDD:287215 21/93 (23%)
LTD 466..572 CDD:279300
vimlNP_957067.1 Filament_head 1..81 CDD:282575 12/66 (18%)
Filament 83..391 CDD:278467 106/359 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0977
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.