DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lam and krt18b

DIOPT Version :9

Sequence 1:NP_001245892.1 Gene:Lam / 33782 FlyBaseID:FBgn0002525 Length:622 Species:Drosophila melanogaster
Sequence 2:NP_956862.1 Gene:krt18b / 393540 ZFINID:ZDB-GENE-040426-1508 Length:405 Species:Danio rerio


Alignment Length:416 Identity:112/416 - (26%)
Similarity:191/416 - (45%) Gaps:58/416 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSKSRRAGTATPQPGNTSTP---RPPSAGPQPPPPSTHSQTASSPLSPTRHSRVA---EKVELQ 59
            :||.|..:..:.|:.|..|:.   :..|||       ..|....|.|:.:..|...   ||.::|
Zfish    36 ISSASAMSYRSAPRSGGISSSTAFKVSSAG-------MGSGAGGSLLASSGSSGGMLGNEKGQMQ 93

  Fly    60 NLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRAR 124
            |||||||.|:|.||.||.||.:|..:::...:....||.:... :.|.|.:.||.:.|...|.||
Zfish    94 NLNDRLAAYLDTVRRLEQENGKLEQQIREALEKGGPETRDYSK-YNAILDDLRRKVFDATVDNAR 157

  Fly   125 AEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEAL 189
            ..:.|                         .|.|:   ..::...|:....|.|:.:..|     
Zfish   158 LVLQI-------------------------DNARL---AVDDFRVKFENEMAIRQSVEGD----- 189

  Fly   190 KELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDG 254
              :..|:|..:||       .:.|:::|..|:||:|||.|..:.|..|::|.|  .|...|.:..
Zfish   190 --IAGLKKVIDET-------NIGRLNVEGEIESLKEELLFLKKNHENEVDELR--SQISQSGVQV 243

  Fly   255 RLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAARTSNSTHKSIEELRSTR 319
            .:.:.....:.|.::::||.||:|...|.:|::..:|.:|..:|...|:.:.:...:..|....|
Zfish   244 DVDAPKGQDMSQVMEDMRANYEKQALKNAEELKMWHETQIADVQVQVAQNTEALQGAQMECNDLR 308

  Fly   320 VRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQD 384
            .:|..|...:...:...|.|...:|:.|.:.:.:.|:....|..||.||.:||..:|:|.:||:.
Zfish   309 RQIQTLEIELASQQNLKASLEDTLRNTEIRSNGEMEKLNNIIIQLEAELAQLRANITEQGQEYEA 373

  Fly   385 LMDIKVSLDLEIAAYDKLLVGEEARL 410
            |:::|:.|:.||..|.|||.||:.:|
Zfish   374 LLNMKMKLEAEINTYKKLLDGEDFKL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LamNP_001245892.1 Filament 54..409 CDD:278467 98/354 (28%)
Ax_dynein_light <283..377 CDD:287215 21/93 (23%)
LTD 466..572 CDD:279300
krt18bNP_956862.1 Filament 87..398 CDD:278467 98/355 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.